PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000325078
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 124aa    MW: 13796.4 Da    PI: 6.2264
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000325078genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.21.4e-2457115260
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                    Fl+k+y++++d+  ++++sws+ g sfvv+d++ f  ++LpkyFkh+nf+SFvRQLn+Y
  MDP0000325078  57 FLNKTYDMVDDPGSNRVVSWSKGGASFVVWDPHAFVMSLLPKYFKHNNFSSFVRQLNTY 115
                    9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.106.9E-2751115IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004154.6E-2353123IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.9E-2253116IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004476.2E-2157115IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.9E-155780IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.9E-1595107IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.9E-15108120IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MTTAALPFFL HFNSNPLKEE YPGSSSSQPC PGFDQTVMMI PPPQPMEGLN DTGPPPFLNK  60
TYDMVDDPGS NRVVSWSKGG ASFVVWDPHA FVMSLLPKYF KHNNFSSFVR QLNTYVSVFS  120
PPSX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d8k_B1e-1755115363Heat shock factor protein 2
5d8l_B1e-1755115363Heat shock factor protein 2
5d8l_D1e-1755115363Heat shock factor protein 2
5d8l_F1e-1755115363Heat shock factor protein 2
5d8l_H1e-1755115363Heat shock factor protein 2
5hdk_A1e-1755115868Heat shock factor protein 2
5hdk_B1e-1755115868Heat shock factor protein 2
5hdk_C1e-1755115868Heat shock factor protein 2
5hdk_D1e-1755115868Heat shock factor protein 2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018506113.11e-72PREDICTED: heat stress transcription factor A-6b
SwissprotQ9M1V53e-35HFA7B_ARATH; Heat stress transcription factor A-7b
TrEMBLA0A498K9201e-66A0A498K920_MALDO; Uncharacterized protein
STRINGXP_008363653.12e-85(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G63350.11e-37HSF family protein