PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000319331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 212aa    MW: 22966.9 Da    PI: 5.1907
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000319331genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.5e-43461451100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+
  MDP0000319331  46 PCAACKILRRRCADKCVLAPYFPPSEPVKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQVNELQAQLAK 141
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  MDP0000319331 142 AQAE 145
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.06845146IPR004883Lateral organ boundaries, LOB
PfamPF031957.6E-4346143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MECSTETMNT NYTTTSSTMS QSPPSSSPSS PPTPTPTPSP PVVISPCAAC KILRRRCADK  60
CVLAPYFPPS EPVKFTIAHR VFGASNIIKF LQELPESQRA DAVSSMVYEA SARIRDPVYG  120
CAGAICHLQK QVNELQAQLA KAQAELVNMQ CQQANLVALI WEMSHPNSEQ GSPPQSLDDN  180
FVATNPHGGN QTNLGFLDDS TTLGSLWEPL WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-44381533118LOB family transfactor Ramosa2.1
5ly0_B3e-44381533118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.115060.0cell culture| fruit| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008370637.11e-157LOB domain-containing protein 1-like
SwissprotQ9SK083e-78LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A498IKK61e-156A0A498IKK6_MALDO; Uncharacterized protein
STRINGXP_008370637.11e-156(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-70LOB domain-containing protein 11