PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000318244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 213aa    MW: 23040.1 Da    PI: 5.5967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000318244genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601377e-43461451100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++C+lapyfp ++p+kf ++h++FGasn++kll++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+
  MDP0000318244  46 PCAACKILRRRCADKCILAPYFPPSEPAKFTIAHRVFGASNIIKLLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQVNELQAQLAK 141
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MDP0000318244 142 AQAE 145
                    9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.1945146IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4346143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MECSTETMNT NYTTTSSTMS QSPPSSSPSS PPTLTPTPSP PVVVSPCAAC KILRRRCADK  60
CILAPYFPPS EPAKFTIAHR VFGASNIIKL LQELPESQRA DAVSSMVYEA SARIRDPVYG  120
CAGAICHLQK QVNELQAQLA KAQAEVVNMQ CQQANLVTLI CMEMSQPNSE QGSPPQSLDH  180
NFITNIPHGG NQTNLGFLDD STTLGSLWDP LWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-44371532118LOB family transfactor Ramosa2.1
5ly0_B2e-44371532118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.115060.0cell culture| fruit| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008363479.11e-158LOB domain-containing protein 1-like
SwissprotQ9LQR02e-77LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A498KG041e-156A0A498KG04_MALDO; Uncharacterized protein
STRINGXP_008358286.11e-157(Malus domestica)
STRINGXP_008363479.11e-157(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-68LOB domain-containing protein 11