PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000317227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 279aa    MW: 30751.1 Da    PI: 9.0356
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000317227genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26078.98.4e-252133198
         DUF260   1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpeeer.............................edamsslv 62 
                    +C++C+vlr++C+++C+l+p++     p++q +++ +v+k+FG++ ++++++a+p+++r                             + +++sl+
  MDP0000317227   2 SCNGCRVLRKGCSESCMLRPCLqwietPEAQGHATVFVAKFFGRAGLMSFISAVPDSQRpgslffrlypsfsrlrfpmfsflifvrlfSVLFQSLL 97 
                    6*********************************************************************************************** PP

         DUF260  63 yeAearardPvyGavgvilklqqqleqlkaelallk 98 
                    +eA+ r+ +Pv+Gavg++++++++++q+++e++ll+
  MDP0000317227  98 FEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLLG 133
                    ******************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.4891136IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-12269IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-692130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MSCNGCRVLR KGCSESCMLR PCLQWIETPE AQGHATVFVA KFFGRAGLMS FISAVPDSQR  60
PGSLFFRLYP SFSRLRFPMF SFLIFVRLFS VLFQSLLFEA CGRTVNPVNG AVGLLWTGNW  120
HVCQAAVETV LLGGTLRPIP ELLGGASTPD EASEADVGGV INCTDMWRLR DPSHNSGSSS  180
RFPSSRSARA SSPKRKRSTA DDESSTKLLQ LQHHADLDLR LTPTMSFKPK PKPETRRPGT  240
PSMNSEESGV TTCFESGFAD HHRSSYSVGP ERKLLNLFP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.54531e-139bud| flower| fruit| leaf| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340959.21e-162LOB domain-containing protein 37-like
SwissprotQ9SN233e-79LBD38_ARATH; LOB domain-containing protein 38
TrEMBLA0A314XUB91e-148A0A314XUB9_PRUYE; LOB domain-containing protein 38
STRINGXP_008340959.11e-164(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72134136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67420.11e-72LOB domain-containing protein 37