PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000313776
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TALE
Protein Properties Length: 310aa    MW: 35133.7 Da    PI: 6.8881
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000313776genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.7e-082592922154
                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    k +yp+++++++L +++gL+ +q+ +WF N+R +
  MDP0000313776 259 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 292
                    469*****************************87 PP

2ELK25.43.3e-09213234122
            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                    ELK +L++++++++ ++++E++
  MDP0000313776 213 ELKIELKQGFKSRIEDVREEIL 234
                    9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.0E-192367IPR005540KNOX1
PfamPF037901.3E-172566IPR005540KNOX1
SMARTSM012564.7E-2480135IPR005541KNOX2
PfamPF037912.3E-1883134IPR005541KNOX2
PROSITE profilePS512139.132213233IPR005539ELK domain
PROSITE profilePS5007111.677233296IPR001356Homeobox domain
SuperFamilySSF466894.28E-16235300IPR009057Homeodomain-like
SMARTSM003891.4E-10235300IPR001356Homeobox domain
CDDcd000862.70E-11236297No hitNo description
Gene3DG3DSA:1.10.10.607.4E-25240298IPR009057Homeodomain-like
PfamPF059201.1E-17253292IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MQESGLGMMG GGGIDGHHXQ HNRQLKAEIA THPLYEQLLS AHVSCLRVAT PIDQLPLIDA  60
QLSQSHHLLR SYASQXQHGX SVSPHERQEL DNFLAQYLIV LCSFKEQLQQ HVRVHAVEAV  120
MACREIESNL QALTGINDQL FWGSXSLSAV LVRSGCGVSL GEGSGATMSD DEDDMQMDFP  180
MDQSGAEGHD MMGFGPLLPT ESERSLMERV RQELKIELKQ GFKSRIEDVR EEILRKRRAG  240
KLPGDTTTVL KNWWQQHSKW PYPTEDDKAK LVEETGLQLK QINNWFINQR KRNWHSNSQS  300
VTSLKSKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12236292864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1289309RKRNWHSNSQSVTSLKSKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.153940.0leaf
Functional Description ? help Back to Top
Source Description
UniProtMay be involved in secondary cell wall biosynthesis. {ECO:0000269|PubMed:15980264}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ0381321e-178JQ038132.1 Prunus persica cultivar Chiripa KNOPE7 (KNOPE7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008373758.20.0homeobox protein HD1-like
RefseqXP_009362836.10.0PREDICTED: homeobox protein HD1-like
SwissprotQ9FPQ81e-167KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A498JKP50.0A0A498JKP5_MALDO; Uncharacterized protein
STRINGXP_008373758.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-165KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Srinivasasainagendra V,Page GP,Mehta T,Coulibaly I,Loraine AE
    CressExpress: a tool for large-scale mining of expression data from Arabidopsis.
    Plant Physiol., 2008. 147(3): p. 1004-16
    [PMID:18467456]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. He JB, et al.
    KNAT7 positively regulates xylan biosynthesis by directly activating IRX9 expression in Arabidopsis.
    J Integr Plant Biol, 2018. 60(6): p. 514-528
    [PMID:29393579]