PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000311934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GeBP
Protein Properties Length: 386aa    MW: 42236.1 Da    PI: 9.4764
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000311934genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573117.76.5e-37159252198
         DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                    klfqr+ws+ Dei++L+G++d+++k+g++p++d+ af+ef+kks++++v k+ql +KirrLKkK++++vkk    k+++ +k+hdqk+f+lskk+W
  MDP0000311934 159 KLFQRIWSDXDEIIILKGMVDYTTKKGADPYSDMGAFHEFIKKSLKVDVXKTQLQDKIRRLKKKYETNVKK----KKFNPTKPHDQKVFDLSKKVW 250
                    579********************************************************************....99999**************** PP

         DUF573  97 gs 98 
                    gs
  MDP0000311934 251 GS 252
                    95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.7E-34161251IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSAED EEVSSEEEGE EEESGSGSDS EPEEPLPPKT SSSAPVSEKK  60
PPPKKPDSSA ANSKPESSSS GSEADSDSDV DKDLVVKPIA SKPMEETPKT KKPRSKPAAT  120
ATPVAKSGSK RPSETEPKDS KRLKKKXPDQ LEEEAKKSKL FQRIWSDXDE IIILKGMVDY  180
TTKKGADPYS DMGAFHEFIK KSLKVDVXKT QLQDKIRRLK KKYETNVKKK KFNPTKPHDQ  240
KVFDLSKKVW GSSSSGEGSS GVSGXSEQPK SNGKXRNTKT LASIRADSLS SPEPPKEAAK  300
VDFGLNPCSS ESLSEVIXFD KGFGKLGLPE GVVKQGLELI GGPKRAELKE KWRKLHVAEL  360
ELFVKRSELM RDQTKVILEA LKSSDH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216229RRLKKKYETNVKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.28351e-154bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028966266.10.0probable transcription factor At1g61730
TrEMBLA0A498IXL30.0A0A498IXL3_MALDO; Uncharacterized protein
STRINGXP_009366247.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.18e-31DNA-binding storekeeper protein-related transcriptional regulator