PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000305695
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 245aa    MW: 27035.4 Da    PI: 9.8027
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000305695genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26079.55.4e-252133198
         DUF260   1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpeeer.............................edamsslv 62 
                    +C++C+vlr++C+++C+l+p++     p++q +++ +v+k+FG++ ++++++a+p+++r                             + +++sl+
  MDP0000305695   2 SCNGCRVLRKGCSESCMLRPCLqwietPEAQGHATVFVAKFFGRAGLMSFISAVPDSQRpgslffrlypsfsxlrfpmfsflifvrlfSVLFQSLL 97 
                    6*********************************************************************************************** PP

         DUF260  63 yeAearardPvyGavgvilklqqqleqlkaelallk 98 
                    +eA+ r+ +Pv+Gavg++++++++++q+++e++ll+
  MDP0000305695  98 FEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLLG 133
                    ******************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.6311136IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-12261IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-692130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSCNGCRVLR KGCSESCMLR PCLQWIETPE AQGHATVFVA KFFGRAGLMS FISAVPDSQR  60
PGSLFFRLYP SFSXLRFPMF SFLIFVRLFS VLFQSLLFEA CGRTVNPVNG AVGLLWTGNW  120
HVCQAAVETV LLGGTLRPIP ELLGGALRDP SHNSGSSSRF PSSRSARASS PKRKRSTADD  180
ESSTKLLQLQ HHADLDLRLT XTMSFKPKPK PETRRPGTPS MNSEESGVTT CFESGFADHH  240
RSSYS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.54534e-91bud| flower| fruit| leaf| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340959.21e-131LOB domain-containing protein 37-like
SwissprotQ9FN111e-71LBD37_ARATH; LOB domain-containing protein 37
TrEMBLA0A314XUB91e-119A0A314XUB9_PRUYE; LOB domain-containing protein 38
STRINGXP_008344349.11e-131(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72134136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67420.17e-69LOB domain-containing protein 37
Publications ? help Back to Top
  1. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]