PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000303022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GeBP
Protein Properties Length: 391aa    MW: 42824.6 Da    PI: 9.5728
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000303022genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573118.63.3e-37166258197
         DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                    klfqr+ws+eDe+++L+G++d+++k+g++p++d+ af++f+kks++++v+ksql  KirrLKkK+ ++vkk    k+ +++k+hdqk+f+lskk+W
  MDP0000303022 166 KLFQRIWSDEDEVIILKGMVDYTSKKGADPYSDMGAFHDFIKKSLKVDVNKSQLQAKIRRLKKKYATNVKK----KKYNLTKPHDQKVFDLSKKVW 257
                    579********************************************************************....8999***************** PP

         DUF573  97 g 97 
                    g
  MDP0000303022 258 G 258
                    8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.9E-34168258IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSSEG QEVSSEEEEG EEEESGSGSD SEPEEPLPXK TSSSAPXAEK  60
KPPPKKPDSS AANSKPQSSS SGSEDDSDSD VDKDLVVKPI ASKPMEETPK TKKPRSKPAA  120
TATPAAKSGS KRPSETEPKD SKRPKKKGAA XEQXPDQVEE EAKKSKLFQR IWSDEDEVII  180
LKGMVDYTSK KGADPYSDMG AFHDFIKKSL KVDVNKSQLQ AKIRRLKKKY ATNVKKKKYN  240
LTKPHDQKVF DLSKKVWGGS GEGXSGXNXP SEQPKSNGKA RNTKTXASIK ADILSSPERS  300
KEAXKXDLGL NPCSLESLSE VIGFDKSFRE LGLPEGVVKQ GLELIGESKR AELKDKWRKL  360
HVAELELFVK RSELMRDQTK VILEALKSSG H
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223236RRLKKKYATNVKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.28350.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371209.20.0probable transcription factor At1g61730
TrEMBLA0A498IXL30.0A0A498IXL3_MALDO; Uncharacterized protein
STRINGXP_008364114.10.0(Malus domestica)
STRINGXP_008371209.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-28DNA-binding storekeeper protein-related transcriptional regulator