PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000300402
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Trihelix
Protein Properties Length: 602aa    MW: 66311 Da    PI: 7.1286
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000300402genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix50.26.9e-1622113272
       trihelix   2 WtkqevlaLiearremeerlrrgk.....................lkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrt 72 
                    Wt+ e++ Liea++ ++er  +++                       + +W++v ++++++g+ r+++qC++kw+nl ++ykk++e e+k t
  MDP0000300402  22 WTEGETMILIEAKKMDDERRMKRSgggeggssgggtdqttrsmskPXELRWKWVEDYCWKKGCLRNQNQCNDKWDNLMRDYKKVREYERKVT 113
                    *************96666665544456666777777777777766899****************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.4461499IPR017877Myb-like domain
PfamPF138372.0E-1121111No hitNo description
PROSITE profilePS5141929.386414602No hitNo description
PRINTSPR004491.5E-30430451No hitNo description
SMARTSM001742.7E-10432592No hitNo description
PfamPF000711.2E-54433587IPR001806Small GTPase superfamily
CDDcd018603.29E-102433587No hitNo description
Gene3DG3DSA:3.40.50.3001.4E-59433586IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM001731.2E-22433593No hitNo description
TIGRFAMsTIGR002311.4E-24433586IPR005225Small GTP-binding protein domain
SuperFamilySSF525405.8E-50433587IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM001752.2E-72433593No hitNo description
SMARTSM001766.2E-4435601No hitNo description
PRINTSPR004491.5E-30453469No hitNo description
PRINTSPR004491.5E-30471493No hitNo description
PRINTSPR004491.5E-30533546No hitNo description
PRINTSPR004491.5E-30568590No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007264Biological Processsmall GTPase mediated signal transduction
GO:0005769Cellular Componentearly endosome
GO:0005783Cellular Componentendoplasmic reticulum
GO:0005886Cellular Componentplasma membrane
GO:0005525Molecular FunctionGTP binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MAEQGGNGTS RVIMRDYRKG NWTEGETMIL IEAKKMDDER RMKRSGGGEG GSSGGGTDQT  60
TRSMSKPXEL RWKWVEDYCW KKGCLRNQNQ CNDKWDNLMR DYKKVREYER KVTNVGEGKG  120
EEGSASYWKL EKNERKERNL PTNMVPQIYE ALVDVVERRE AGGGGYQXRG HEVVGGASVS  180
GPNVXINPNI GYGLERPIIS TTNVHQQPSS SLPSPPVLQH HHHQISVPTI AALPLLPPAP  240
LAAQPPXALP YAQVMPTVDS DTSEHSDSPA KRRRRASGRG GGGGEDQGGX SGTVSASISS  300
EVGTAIARGA SVIAEALQGC XEREERRHRX MLNLHERRLQ IEETKTEINR QGINGLTDAI  360
NKLANVCHAV KIEVGIEHFS RIIYEIVKRR LFLVVVVQAA KVDFSSDVLR VSENTTYCDS  420
GLIAFLLYDI IQVLLGDVGA GKSSLVLRFV KGQFVEFQES TIGAAFFSQT LAVNDTTVKF  480
EIWDTAGQER YHSLAPMYYR GAAAAIIVYD LTNQASFERA KKWVLELKSQ GNPNMVMALA  540
GNKADLVEAR KVAAEDAQSY AQENGLFFLE TSAKTADNVN DIFYEIGTFI GSLACTPFSA  600
MN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2efc_B8e-9543358716170Small GTP-binding protein-like
2efc_D8e-9543358716170Small GTP-binding protein-like
2efd_B8e-9543358716170Small GTP-binding protein-like
2efd_D8e-9543358716170Small GTP-binding protein-like
2efe_B8e-9543358716170Small GTP-binding protein-like
2efe_D8e-9543358716170Small GTP-binding protein-like
2efh_B8e-9543358716170Small GTP-binding protein-like
2efh_D8e-9543358716170Small GTP-binding protein-like
4g01_B8e-9543358716170Ras-related protein RABF2b
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.33330.0bud| cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371840.20.0uncharacterized protein LOC103435230 isoform X2
TrEMBLA0A498IYR30.0A0A498IYR3_MALDO; Uncharacterized protein
STRINGXP_008371840.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68043242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35640.16e-56Trihelix family protein