PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000296843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family VOZ
Protein Properties Length: 543aa    MW: 61395.9 Da    PI: 6.2902
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000296843genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ394.13.3e-1212164301217
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pp saflgpkcalwdc+rpaq    +qdycss ha la neglpg tpvlrp+gi lkdg+lf al+ k+qgk+vgip+c+gaat +spwn +elf
  MDP0000296843 216 PPVSAFLGPKCALWDCSRPAQV--LCQDYCSSGHALLARNEGLPGNTPVLRPGGIALKDGSLFXALNXKTQGKDVGIPNCDGAATLRSPWNDSELF 309
                    788*****************97..6*********************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                    dlslleget+rewlff +prrafesgnrkqrslpdysgrgwhesrkqvmke+gg+krsyymdpqpss +ewhl+eye+n++da+alyrlelk   +
  MDP0000296843 310 DLSLLEGETLREWLFFGRPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKEYGGQKRSYYMDPQPSSDHEWHLFEYEVNNSDACALYRLELKFGTA 405
                    ************************************************************************************************ PP

            VOZ 193 kksakgkvskdsladlqkklgrlta 217
                    kks+kgk s+d+ladlqkk+grlta
  MDP0000296843 406 KKSSKGKQSNDPLADLQKKMGRLTA 430
                    ***********************97 PP

2FAR137.95.9e-12476530248
           FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk........t 48 
                     Yn+Y ++vGFs+rk++++k+k+++e+t+r + Cskeg+r ++k++        +
  MDP0000296843 476 LYNAYRRKVGFSIRKDRHYKNKKTNEVTSRIYACSKEGFRLQDKRDyktrkpykS 530
                    7*****************************************9999554444431 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.2E-9476533IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MLKDSKGKCE AASHKLLKEK AKTRVQELQG MVTNIQIARN EGRTADIAIW EDQMHQMLGG  60
WGAELNDPSP ASSLHGGSHG SLGSFSEELA RLLKQHCDEK DDAESPLKEL PQPKLEGPEP  120
NLQNPHSINF TEFTEDFFVS SKEPQEDIFQ GLDLDQCHTA XNFPNTMVDI PDLTTQMNNN  180
HFEFPDYLNE GPFITHSDIK QSEEDVVPNV MPDICPPVSA FLGPKCALWD CSRPAQVLCQ  240
DYCSSGHALL ARNEGLPGNT PVLRPGGIAL KDGSLFXALN XKTQGKDVGI PNCDGAATLR  300
SPWNDSELFD LSLLEGETLR EWLFFGRPRR AFESGNRKQR SLPDYSGRGW HESRKQVMKE  360
YGGQKRSYYM DPQPSSDHEW HLFEYEVNNS DACALYRLEL KFGTAKKSSK GKQSNDPLAD  420
LQKKMGRLTA EASTEIQLKM IDSEEANNIN NDDSIEFDCT ARCGVEFDSQ EAAYNLYNAY  480
RRKVGFSIRK DRHYKNKKTN EVTSRIYACS KEGFRLQDKR DYKTRKPYKS NSKKDQKQAK  540
KIT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.79770.0fruit| leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009354289.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-154VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM5WU250.0M5WU25_PRUPE; Uncharacterized protein
STRINGXP_008342877.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-149vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]