PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000296708
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Trihelix
Protein Properties Length: 296aa    MW: 35412.6 Da    PI: 8.8422
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000296708genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.13.1e-2553135186
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                    +W+ qe+++L+ +r e+++++ ++k++k lWe +s km+e+g +rs++qCk+kw+nl +ryk ++++e +   + ++++p++++l+
  MDP0000296708  53 QWSVQETKDLLLIRAELDQTFMETKRNKLLWEVISTKMKEKGHHRSAEQCKCKWKNLVTRYKGCETMEPE---PMRQQFPFYNELQ 135
                    7********************************************************************8...45668******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819959.94E-5440No hitNo description
SMARTSM007170.002850112IPR001005SANT/Myb domain
CDDcd122037.92E-2152117No hitNo description
PfamPF138372.3E-2053137No hitNo description
PROSITE profilePS500907.28254110IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MEHHPHHFQH HHQQQHHPQQ LQLQQQQQQQ QQLQQQHPST ATVHVDASDR FPQWSVQETK  60
DLLLIRAELD QTFMETKRNK LLWEVISTKM KEKGHHRSAE QCKCKWKNLV TRYKGCETME  120
PEPMRQQFPF YNELQAIFAA RIQRMLWAEE SGAASGSKKK TLSSDDEEDN EDSEAENKGS  180
TARNKKKKVK MSNIGSSGTS GSASGNNVRE ILEGFMKQQM QMEMQWREEF QARENERRLK  240
EMEWRQRMEA LENERIMMXT RWREREEQRR LREEARAEKR DALITALLNK LRREDM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008390687.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW09e-75TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A103YLU91e-115A0A103YLU9_CYNCS; Myb-like domain-containing protein
STRINGPOPTR_0006s10240.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-55Trihelix family protein