PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000296303
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 835aa    MW: 93295.9 Da    PI: 8.8707
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000296303genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.92.6e-14758804551
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                    +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+ +  +
  MDP0000296303 758 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELQXKQAQ 804
                    79*************************************99866544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031401.8E-8364414IPR004158Protein of unknown function DUF247, plant
Gene3DG3DSA:1.20.5.1702.0E-15751807No hitNo description
SMARTSM003381.7E-12754820IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.3756807IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.38E-10758806No hitNo description
CDDcd147079.63E-26758812No hitNo description
PfamPF001703.8E-12758807IPR004827Basic-leucine zipper domain
PROSITE patternPS000360761776IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MKHIRVAGSS SSYISVFSLF KADFQLIDXN AHEMEANNVR NKNLASSIQG KLQQQSPLRS  60
HHSIFRVPNV LRNDNERVYV PRLISIGPLH RGSKLQTMEG IKLWYLHCLL QRDQTRKTGL  120
EHFVEAIRDI EQDCRDSYEE QIDMSSDDFV EMLVVDGCFI IELFRKSSGE VPTKEEDPVF  180
HKSWIHTPLI NDLLLLENQL PWIVLDRLFD LTLETSAGNN NHISLPEITL RYFEVYSLGM  240
LSRTYRASGS KHLLDFIRNS LIGWYQSDDA HMPLSLFKIP SATELAGSGI ILTTGRKYDG  300
MLNITFEXXV LRIPPIRVCK NGESLFRNLV AYEQCETTTG VSKYASYAVL LDHLIKSKED  360
VELLVKRGVI ENFXDDMAWL LNNLSNGIIV YNFTYRRIYE XLNTFCXTRW XRFHRKMGTN  420
MNFKGFGNEP PLARQSSIYS LTFEELQNTI GGPGKDFGSM NMDELLKSIW TAEETQIMAP  480
AGGAAGGQEG LGHGGGGSLQ RQGSLTLPRT LSQKTVDEVW KNLSKEGTGA GGXNMPQRQQ  540
TLGEMTLEEF LVRAGVVRED AQMAPKPNGA SFYGDLSRFG NSGSLGFEFQ QLNRGIGVMG  600
NRVPENNNNL VPNQGSNLPL NANGVRSNQH QQQQQMPQQQ QQHQIFPKQQ PVTFNTSQLP  660
IGPNTQLGSP GMRGGMMGIG DQGMNGXLAP SSGMGMVGLG AAGAIRVATP SPANQLSSDG  720
VGKSNGTDTS SVSPVPYVFN GGFRGRKGGG PVEKVVERRQ RRMIKNRESA ARSRARKQAY  780
TMELEAEVAK LKEENQELQX KQAQMAEVQK NQDMEILNLQ RGKKRCXRRT XTGPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.304410.0bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700610.0KC770061.1 Pyrus pyrifolia microsatellite TXY164 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028951036.10.0UPF0481 protein At3g47200-like isoform X1
TrEMBLA0A498HMP60.0A0A498HMP6_MALDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.13e-84abscisic acid responsive elements-binding factor 2