PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000295058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GRAS
Protein Properties Length: 344aa    MW: 38988.6 Da    PI: 6.4219
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000295058genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS59.85.7e-19137774138
           GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138
                    ++ ++  l  f +++P+++f++ ++N aI eaveg + vHi+D+++++++Q p+L +a+asR+++
  MDP0000295058  13 HKFSIVELASFIDLTPWHRFGFTATNAAIXEAVEGYSVVHIVDLSLTHCMQIPTLVDAIASRQDE 77 
                    3333444445****************************************************864 PP

2GRAS1011.8e-3193263186330
           GRAS 186 ledleleeLrvkp.gEalaVnlvlqlhrll..........................desvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                    + +l++++L   + gEal+Vn++++lh++                           ++s s++s r+ +Lk + +l P++vv+v++++d++s++++
  MDP0000295058  93 IXQLRVQNLVYAEsGEALVVNCHMMLHYISeealtlpainpnpsssgstssyafdvASSSSSSSLRTVFLKXLGGLDPTIVVLVNEDVDLTSNNLV 188
                    56788888877778*****************************************9999999999******************************* PP

           GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330
                     r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a eg++r+er e + +W +r+++a F++v+++
  MDP0000295058 189 CRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-VCWKIENVIAYEGFQRVERLEPKCRWVQRMRNANFRSVSFG 263
                    **********************************.99***********************************9876 PP

3GRAS47.33.6e-15264341293373
           GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                    +i+nv+a eg++r+er e + +W +r+++a F++v+++++a++++k++l +++   + ++ e++ +vl+ k++++v+++aW
  MDP0000295058 264 KIENVIAYEGFQRVERLEPKCRWVQRMRNANFRSVSFGKDAVSEVKAMLDEHG---WGLKREEEDVVLTLKGHNVVFATAW 341
                    7**************************************************99...45777788888999*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098521.0571325IPR005202Transcription factor GRAS
PfamPF035142.0E-161377IPR005202Transcription factor GRAS
PfamPF035146.2E-2993263IPR005202Transcription factor GRAS
PfamPF035141.2E-12264341IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MANSQANFTI HTHKFSIVEL ASFIDLTPWH RFGFTATNAA IXEAVEGYSV VHIVDLSLTH  60
CMQIPTLVDA IASRQDEFRV IPSSYTDGFA NLIXQLRVQN LVYAESGEAL VVNCHMMLHY  120
ISEEALTLPA INPNPSSSGS TSSYAFDVAS SSSSSSLRTV FLKXLGGLDP TIVVLVNEDV  180
DLTSNNLVCR LRSAFNYLWI PYDTVDTFLP RGSKQRQWYE ADVCWKIENV IAYEGFQRVE  240
RLEPKCRWVQ RMRNANFRSV SFGKIENVIA YEGFQRVERL EPKCRWVQRM RNANFRSVSF  300
GKDAVSEVKA MLDEHGWGLK REEEDVVLTL KGHNVVFATA WMPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B1e-1623262118372Protein SHORT-ROOT
5b3h_E1e-1623262118372Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.113110.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008338421.20.0scarecrow-like protein 32
SwissprotQ9SN221e-106SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A498HVF50.0A0A498HVF5_MALDO; Uncharacterized protein
STRINGXP_008361432.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-107GRAS family protein