PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000288452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 1572aa    MW: 176177 Da    PI: 9.5926
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000288452genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like69.55.4e-22210263155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kp+++W + LH +F+ a++++ G ++A+Pk+ile+m+v+gLt+++v+SHLQkYR+
  MDP0000288452 210 KPKVVWINSLHYQFLLAIRHI-GFDRAVPKNILEFMNVPGLTRANVASHLQKYRI 263
                    79*******************.********************************6 PP

2DUF260102.15.1e-327118083100
         DUF260   3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                    a Ck+lrr+C++dC+++ yfp ++p++fa vh+++Gasnv+k+l++lp++ r +a+++l+yeAe+r++d v G+v++i++l+q++ +++ +la+++
  MDP0000288452 711 ATCKYLRRRCPSDCIFSSYFPPNNPQRFASVHRIYGASNVSKMLQQLPNHLRAEAADALCYEAECRIQDSVCGCVKTIFQLHQEIYNAECQLAKTR 806
                    78*******************************************************************************************999 PP

         DUF260  99 ee 100
                    +e
  MDP0000288452 807 AE 808
                    87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521722.28E-3323141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.4E-3523147No hitNo description
SMARTSM004484.8E-3124136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.43125140IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.1E-2226134IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.01E-2727139No hitNo description
Gene3DG3DSA:3.40.50.23002.4E-35182187No hitNo description
SuperFamilySSF466896.63E-16207267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-22208267IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-21210263IPR006447Myb domain, plants
PROSITE profilePS5089120.354708809IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-32711806IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:3.30.70.3308.4E-1811621242IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010216.38111681240IPR000504RNA recognition motif domain
CDDcd122346.01E-4011681239No hitNo description
SMARTSM003604.6E-1511691236IPR000504RNA recognition motif domain
SuperFamilySSF549283.31E-3411691336IPR012677Nucleotide-binding alpha-beta plait domain
PfamPF000761.0E-1211701228IPR000504RNA recognition motif domain
Gene3DG3DSA:3.30.70.3303.4E-2012551336IPR012677Nucleotide-binding alpha-beta plait domain
PROSITE profilePS5010216.02312611332IPR000504RNA recognition motif domain
SMARTSM003604.0E-1812621328IPR000504RNA recognition motif domain
CDDcd124662.80E-3812621331No hitNo description
PfamPF000762.4E-1312631325IPR000504RNA recognition motif domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0031053Biological Processprimary miRNA processing
GO:0010445Cellular Componentnuclear dicing body
GO:0016607Cellular Componentnuclear speck
GO:0000166Molecular Functionnucleotide binding
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1572 aa     Download sequence    Send to blast
MDATDSAEFR QSSSNSKVSF ADTINILVVD DDATTLTIVS AMLKTWNYKV VPVKNPIDAL  60
ATLREQKGAF DLVVTDLHMP EMDGFELQKH VRDEFKLPVI MMSADDNESV ILKSLEGGVA  120
YYIVKPVSKD DIKNVWQYAV AAKKGKSVVI GEIECAPKEA PGEVDDGSNS EISSDTNEEQ  180
HKKKAEAKTK KAKKRGREDD NEERMVAPKK PKVVWINSLH YQFLLAIRHI GFDRAVPKNI  240
LEFMNVPGLT RANVASHLQK YRIFLKRVAE KARLSKCLSE RVFRSSFAVG HPGPVFNSTE  300
AGDQYSQYLK LQQQTGASPI NASAFQPSSA GIDENTINLL GLIQCPNYQR SSRSSNTMRS  360
MTQLISSGQS RLLNHITQAN LLRHQPWLGN VNHQLLSQVS RRRGDFGMQQ LMNNLGSSGG  420
MSSNAANITG LTTNNILASN LIQMFPQARQ QGIFTNNNPF SYNFGTSGIQ NNFINQQLIG  480
NFSGTHPNCR SEILGKLNNL NGTGGLSSNG FNFNNDTINA LTNGVRNVSL SGTTAPMATL  540
GGSLSSSSSA GFETSTTTSS ANQFSKVFNK NKEDQQQNVS VLPPPAENND NNSTTAPILQ  600
QGGDQDQLPP DFSSFLYPDE VPDATPNQMN PTAADQGLDT AVNKVSDPSA DQVPNSNSSG  660
TYSVKENAPN EQSWSQRQGG DQQVLNPEFR GNVFDPEDYN MLFETPLPFP ATCKYLRRRC  720
PSDCIFSSYF PPNNPQRFAS VHRIYGASNV SKMLQQLPNH LRAEAADALC YEAECRIQDS  780
VCGCVKTIFQ LHQEIYNAEC QLAKTRAEIA LTNSRGGGGQ KNQVNHLHAL HWPPWRARLS  840
GQVPRHRLRQ HHRLLHPPWP RHGNGTHLRP RFWRQKTHYA RPLFAEDALA IISSTFPSTI  900
FSFRTSIWES KKGRKLCLQQ CPGLGPQQWG LFDSELRPAL ELDKHKQSSL ISALLGLSSS  960
TPNSEATSLN QRTKTCYLRH HSLFGLLAPM SLPTPVETLK LKEEGNMQIK AAVRNEKIVY  1020
GNVGDRQSDG LTSEVNSQRV EKRLSEKIRE RIQLSFGSDR FILAADEDDF LHVQPEKRNG  1080
EAEQSVFSGA KSLAADELHS HGEAGEYGVT GYVGGSPFGQ IEESITYFLH VARLLRFESE  1140
APLLPKRRIC IFFDRLVFCS TASRKEMKPI FCGNFEYDAR QNELERLFGR YGKVDRVDMK  1200
SGFAFIYMED ERDAEYAIRG LDRKEFGRKG RRLRVEWTKQ ERGARRPGAS RRSSTNTRPS  1260
KTLFVINFDP YHTRTKDLER HFDSYGKIVS VRIRRNFAFV QYESQEDATR ALEATNMSKL  1320
MDRVISVEYA VRDDDERGDG FSPDRRSRDR SPDRGRDRRR SPSPYKRERG SPDYGRGPSP  1380
GPYRRERGSP DYGRAASPYR RERVSSDYGR GRSPSPYRRD RSDHGRVSSR SPRKERVSAD  1440
RVHDRTRSPY GRERPGDDNG HGPSRSSYKR DRGSPENGPR RSPYKRERDS PRDSPENGRL  1500
PSSSPYKRER VSPENGGGPS GSPYETERAS PENGRVASLN SAPEARDSPN YGGPESPMNE  1560
RYSSRSPQAE EE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-2771180913111LOB family transfactor Ramosa2.1
5ly0_B5e-2771180913111LOB family transfactor Ramosa2.1
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.78940.0bud| fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A498JHF80.0A0A498JHF8_MALDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF252122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-58response regulator 2