PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000285637
Common NameHD3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 828aa    MW: 89917.4 Da    PI: 6.3033
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000285637genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.2e-21118173156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  MDP0000285637 118 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 173
                    688999***********************************************999 PP

2START206.79.2e-653255481205
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ +ep+W +s     e +n +e++++f++  +     + +ea+r+sg+v+ ++ +lve+l+d++ +W e+++    + +t++
  MDP0000285637 325 ELALAAMDELVKMAQTDEPLWLRSLeggrEVLNHEEYMRSFTPCIGlkpsgFVSEASRESGMVIINSLTLVETLMDSN-RWLEMFPgviaRTSTTD 419
                    5899************************99***********99999********************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vissg      galqlm aelq+lsplvp R++ f+R+++ql +g+w++vdvSvd+ ++ +  + ++ +++lpSg+++++++ng+s+vtwveh+++
  MDP0000285637 420 VISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQLAEGVWAVVDVSVDVIRDTSGAPTFMNCRRLPSGCVVQDMPNGYSRVTWVEHAEY 515
                    ***********************************************************999********************************** PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqce 205
                    +++++h+l+r+l++sg+ +ga++wvatlqrq e
  MDP0000285637 516 DESQVHQLYRPLLSSGMGFGAQRWVATLQRQSE 548
                    ******************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-21102175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-22103169IPR009057Homeodomain-like
PROSITE profilePS5007118.058115175IPR001356Homeobox domain
SMARTSM003893.6E-19116179IPR001356Homeobox domain
PfamPF000468.1E-19118173IPR001356Homeobox domain
CDDcd000861.19E-19118175No hitNo description
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PROSITE profilePS5084842.662316552IPR002913START domain
SuperFamilySSF559613.37E-32318548No hitNo description
CDDcd088752.66E-124320548No hitNo description
PfamPF018527.4E-57325548IPR002913START domain
SMARTSM002341.8E-49325549IPR002913START domain
SuperFamilySSF559617.46E-22575752No hitNo description
SuperFamilySSF559617.46E-22782798No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 828 aa     Download sequence    Send to blast
MSFGGFLDNS TGSSGGARIV ADIPYTNSNN NMPSSAIAQP HLVTQSLTKS MFNSPGLSLA  60
LTNVDGQGDV TRVAESYEAN NGGRRSREEE HESRSGSDNM DGASGDDQDA ADNNPRKKKR  120
YHRHTPQQIQ ELEALFKECP HPDEKQRLEL SRRLNLETRQ VKFWFQNRRT QMKTQLERHE  180
NSLLRQENDK LRAENMSIRD AMRNPICSNC GGPAIIGDIS LDEQHLRIEN ARLKDELDRV  240
CXLAGKFLGR PISSLATSMG PPLPSSTLEL GVGSNGFGGM SNVATSISMG PDFGGGIGSA  300
MSIVSHGRPS VTGLDRSIER SMFLELALAA MDELVKMAQT DEPLWLRSLE GGREVLNHEE  360
YMRSFTPCIG LKPSGFVSEA SRESGMVIIN SLTLVETLMD SNRWLEMFPG VIARTSTTDV  420
ISSGMGGTRN GALQLMHAEL QVLSPLVPVR EVNFLRFCKQ LAEGVWAVVD VSVDVIRDTS  480
GAPTFMNCRR LPSGCVVQDM PNGYSRVTWV EHAEYDESQV HQLYRPLLSS GMGFGAQRWV  540
ATLQRQSEFQ AILMSSSVPS RDHTGFFVKA ITASGRRSML KLAQRMTDNF CAGVCASTVH  600
KWTKLNAGNV DEDVRVMTRE SLDDPGEPPG VVLSAATSVW LPVSPQRLFD FLRDERLRSE  660
WDILSNGGPM QEMAHIAKGQ DPGNCVSLLR ARANANQGSM LILQETRIDA AGSLVVYAPV  720
DIPAMHVVMN GGDSAYVALL PSGFAIVPDG PGSRGPMSGK GATHGSSNGG GCGDDGGNRV  780
SGSLLTMTFQ ILVNSLPAGK LTVESVETVN HLISCTVQKI KASLHCES
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.29280.0bud| fruit| leaf| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0679610.0AF067961.1 Malus domestica homeodomain protein (h3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383260.20.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLD9ZJ180.0D9ZJ18_MALDO; HD domain class transcription factor
STRINGXP_008383252.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]