PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000284409
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 431aa    MW: 47835.8 Da    PI: 8.339
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000284409genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.53.1e-452643631100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la 
  MDP0000284409 264 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDALQTQLAI 359
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MDP0000284409 360 AQAE 363
                    9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.201263364IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-44264361IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MECENDIKVF HKSTERQRVY VFLGGLXDMF DQVRGEVLRX DPPLGLQXSY AYVRREADRX  60
EAMKIEVEKS XPAXMXAKAR GSSSWSNKDG SQNRPXPTRP SQTSRDRPQG DQQQPANQHI  120
VQPTGPTGVR LERYMQDQPS GHTGFGLESE LQPTVFDXTE PQQHTSVNST EXQLSQNASP  180
NVIXGXSMDS SSVNSYNQSS STPDAPXLRR LPXRRIHSNL IFRSISLQAI SASCGRSARG  240
TPRTSRTAEK MESQSGRKQG STSPCAACKL LRRRCAQDCV FAPYFPADEP QKFASVHKVF  300
GASNVNKMLQ ELPEHQRSDA VSSMVYEANA RVRDPVYGCV GAISSLQQQI DALQTQLAIA  360
QAEVVHMRMG QFAITTTTAS TTTCSPDQKM APDNSHHHHH HRSHQTATTK SFFSMDMAAD  420
QANMGESLWS C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-462603837130LOB family transfactor Ramosa2.1
5ly0_B7e-462603837130LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.18e-68LOB domain-containing protein 4