PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000282906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 402aa    MW: 45146.6 Da    PI: 10.1047
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000282906genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.9e-132064147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
    MDP0000282906 20 RESWTDQEHDKFLEALQLFDRD-WKKIESFVG-SKTVIQIRSHAQKY 64
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-161470IPR009057Homeodomain-like
PROSITE profilePS5129414.8471569IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-61870IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-181867IPR006447Myb domain, plants
SMARTSM007178.6E-111967IPR001005SANT/Myb domain
PfamPF002491.4E-102064IPR001005SANT/Myb domain
CDDcd001676.67E-82265No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MSADDQSKKI RKPYTITKSR ESWTDQEHDK FLEALQLFDR DWKKIESFVG SKTVIQIRSH  60
AQKYFLKVQK KGTSEHVPPP RPKRKATHPY PQKAPKIAAV VSQVAGPFQS SSDLLEHGYV  120
YQPDSSFVLG TPVNSATLSS WSCNSMPPVN MSQTKDEGRL SGQTVTHNSC YSSSNESNPI  180
NWXMRXXVDG VDPGQPQRVT SVVLRTWIVL GPLCPGPCPP YDPQFKMSLV TRRGHSPCCG  240
SLRKEAFGKR LLTYGEAFRR PTTTWRAIAK LRKXEAVASR MKXSRYDSQA KGARPSRATS  300
GVAKNAYYMY TGLVIVLLVL TIVPVYAVLP DFAQVYKFIG SVFDPSTSNH MERLRQLDPI  360
NLETALLLMR NLSINLTRPE FEDHAVVATQ VLDLLYSAEL VK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.166160.0bud| fruit| leaf
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR7148682e-57FR714868.1 Malus x domestica mitchondrial complete genome, cultivar Golden delicious.
GenBankKR5346062e-57KR534606.1 Malus hupehensis var. mengshanensis mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001315697.11e-135protein REVEILLE 5-like
RefseqXP_008375972.21e-135protein REVEILLE 5-like isoform X1
SwissprotQ8H0W31e-59RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A498JEU21e-133A0A498JEU2_MALDO; Uncharacterized protein
TrEMBLD9ZJ831e-134D9ZJ83_MALDO; MYBR domain class transcription factor
STRINGXP_008375972.11e-138(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.15e-62MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]