PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000280087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 1182aa    MW: 130570 Da    PI: 6.0069
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000280087genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.39.2e-37101091100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rrkCakdC+lap+fpa+qp  f+n+h+l+G+sn++k+lk++++e+ e+am+s++ye+++ra+  v G++g+i++l+ ql+q+ +el +
  MDP0000280087  10 ACAACKYHRRKCAKDCALAPHFPADQPMMFQNAHRLYGVSNIMKILKKVHPEQEEEAMTSIIYESNMRAKFSVTGCMGIINQLNFQLQQALEELRY 105
                    7*********************************************************************************************99 PP

         DUF260  97 lkee 100
                    ++++
  MDP0000280087 106 VRTN 109
                    8865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4999110IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-3510107IPR004883Lateral organ boundaries, LOB
Gene3DG3DSA:2.120.10.301.3E-94477941IPR011042Six-bladed beta-propeller, TolB-like
SuperFamilySSF509522.62E-21492591IPR011041Soluble quinoprotein glucose/sorbosone dehydrogenase
PfamPF079958.3E-23509858IPR012938Glucose/Sorbosone dehydrogenase
SuperFamilySSF509522.62E-21630685IPR011041Soluble quinoprotein glucose/sorbosone dehydrogenase
SuperFamilySSF509522.62E-21723820IPR011041Soluble quinoprotein glucose/sorbosone dehydrogenase
PfamPF015350.489991012IPR002885Pentatricopeptide repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0016901Molecular Functionoxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor
GO:0048038Molecular Functionquinone binding
Sequence ? help Back to Top
Protein Sequence    Length: 1182 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYHRRK CAKDCALAPH FPADQPMMFQ NAHRLYGVSN IMKILKKVHP  60
EQEEEAMTSI IYESNMRAKF SVTGCMGIIN QLNFQLQQAL EELRYVRTNL AICKDQCQYR  120
LPSSSPHYSS PSPQLQLGIP TNTDAATLTL YQQHQYPYQY ASGAAGASGG MSWVGNEYLA  180
NGLNGVYIDD NDNMVKPLRV QHPYYNDNNV EQLMAVQSSL VSSQAFPVHQ EMDVPHDYDD  240
IPFDTIADDR QSYIESKEAC ESSAESSFKG TTQSIEHVSN DLKSAAACFS LTSQSHTRPR  300
DEGLANGSME LRCLSQFLWR ESLGLKCVAR GSPITPKTPL NFCRYNGSVC CDSAEDLRLQ  360
NLFKAMNVSD LGCASLVKSI LCSRCDQFSA ELYRFESAPR QVPLLCNSSQ HQPGGVDFCS  420
KVWDECQNVA LLNSPFSLQV GGGTPSNSTS KLSDTWQSKT AFCNAFGGSS NDESFCFDGG  480
PVLLNSTEIP SPPSGMCLEK IGNGSYLNMV AHPDGSNRVF LSDQAGKVWL ATVPEEESGE  540
TLVIDEANPF LDITDQVYSD TELGMMGLAF HPNYVQNGRF FASFNCDKVT WPQCSGRCSC  600
NSDVGCDPSK LEPDNGGQPC QYHSIIAEFT ANATTPQPSS FASVKPLEVR RIFTMGLPFT  660
THHAGQILFG PKDGYLYFMM GDGGSIGDPY NFAQNKKSLL GKIMRLDIDN IPSAKEIAXL  720
GLWGNYSVPG DNPFTEDEEL RPEIWALGFR NPWRCSFDLE RPSYFLCADV GQDQYEEVDL  780
VTKGGNYGWR VYEGPFRYNP PKSPGGNTSA SSINPIFPVM GYTHSEVNKA EESASITGGY  840
FYRSTTDPCM YGRYIYADLY ASXIWTGLET PEGSGNFTTA KIAVSCALDS PIQCGAEAGS  900
SVTALGFIFS FGQDNRKDIF MLTSSGLYRV AKPSRCNYTC SIENVTSSSP PKSVPSPPPS  960
PSSTGRLNNP LTLELLIIFC TLLLPFRCSL RTDIEQKVVT YNTMIKIYGK RGVQLNAITY  1020
STIKAGKLDR AAMLFQKLRR SGVXIDQVIV AYDKLGLVAH AKRLLHELKR PDNIPRGTAI  1080
TILARAGRIE EATWVFRQAF EAGEVKDISV FGCTIDPFSR NQNLYGARKD FKMVEALFER  1140
LISDPNINEL HLVVASIYDR SNRLNDASGI XNKMTERRIR MS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2361107111LOB family transfactor Ramosa2.1
5ly0_B3e-2361107111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341526.20.0HIPL1 protein-like
SwissprotQ9SSG30.0HIPL1_ARATH; HIPL1 protein
TrEMBLA0A498HHK30.0A0A498HHK3_MALDO; Uncharacterized protein
STRINGXP_008341526.10.0(Malus domestica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-36LOB domain-containing protein 27
Publications ? help Back to Top
  1. Sherrier DJ,Prime TA,Dupree P
    Glycosylphosphatidylinositol-anchored cell-surface proteins from Arabidopsis.
    Electrophoresis, 1999. 20(10): p. 2027-35
    [PMID:10451111]
  2. Dunkley TP,Watson R,Griffin JL,Dupree P,Lilley KS
    Localization of organelle proteins by isotope tagging (LOPIT).
    Mol. Cell Proteomics, 2004. 3(11): p. 1128-34
    [PMID:15295017]
  3. Borner GH, et al.
    Analysis of detergent-resistant membranes in Arabidopsis. Evidence for plasma membrane lipid rafts.
    Plant Physiol., 2005. 137(1): p. 104-16
    [PMID:15618420]