PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000278334
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 261aa    MW: 28908.8 Da    PI: 8.9377
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000278334genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-42801791100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+C+++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++gvi++lqqq+++l+ael++
  MDP0000278334  80 PCAACKLLRRRCSQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPETQRADAANSLVYEANVRLRDPVYGCMGVISALQQQVQSLQAELNA 175
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    ++ e
  MDP0000278334 176 VRGE 179
                    9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.87979180IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4280176IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MKRIKREPRN GNKKECCAEI TFLSIVVLYV SSQFCLCISA SRERFDEVGK KFXRETDASH  60
YQMGRRHMLG PPGTLNTITP CAACKLLRRR CSQECPFSPY FSPHEPQKFA SVHKVFGASN  120
VSKMLMEVPE TQRADAANSL VYEANVRLRD PVYGCMGVIS ALQQQVQSLQ AELNAVRGEI  180
LKYKYREANL LPSNSHHHMA LFSTSGAVSV ASLPQTPQPP PPPSPPPPLP PTSSSSSMYT  240
NQQTSAVDYT SLSSENVSFF G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-45721933124LOB family transfactor Ramosa2.1
5ly0_B8e-45721933124LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754452e-31HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755182e-31HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028958020.11e-162LOB domain-containing protein 15-like
RefseqXP_028958025.11e-162LOB domain-containing protein 15-like
SwissprotQ8L5T55e-85LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A498KMK01e-138A0A498KMK0_MALDO; Uncharacterized protein
STRINGXP_009369256.11e-130(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-84LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]