PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000277999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 719aa    MW: 81214 Da    PI: 8.6573
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000277999genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31e-10433463333
                    XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLee 33 
                    ++k++rr+++NReAAr+sR RKka++++Le+
  MDP0000277999 433 ADKVQRRLEQNREAARKSRMRKKAYVQQLET 463
                    79***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF142235.0E-10188No hitNo description
Gene3DG3DSA:1.20.5.1706.8E-9430480No hitNo description
SMARTSM003382.9E-4431491IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.76433470IPR004827Basic-leucine zipper domain
PfamPF001702.7E-7433464IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.19E-7435467No hitNo description
PROSITE patternPS000360438453IPR004827Basic-leucine zipper domain
PfamPF141443.1E-25522595IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MEHIIGCXIS HXAWTCLQER LAYVSMVRIN QLKSEFHTIQ KGGESVNKFL PRVKAIIDQL  60
VSAGEKIIEN DFLIAVLSXL PXEFEMIKIY KGXNNNNSRS FXSNFXNKNG NGNTSDNLSG  120
NGKSXQNNGH SFSNGDAWIL DTGAIHHMTT NANALSQVNP YNGDEKIIIG NGEDIHNFKV  180
FGXAIYPLXG PYTVNKLQAR SSKCVFLGYA LGYKRAICYD XQNXMLVXSR HVAEKLAGKI  240
DDAXVEGXAX APRAGTXNPS LAPTXLHARX GVWVEMRGRD FVPVSRXEWL XSXRFWLESH  300
EFAXEVXVAS XCLXAPQRKX EREEXASRSR RYNSSGTKES LRQSDXXKFE VIVYKSMSYS  360
STQFATSRQM GIYEPFRQIG VWKETFRGDH TSNTAASTIL EEDSGIENKI GFVSHEPMLP  420
SGNGNDHEPS RSADKVQRRL EQNREAARKS RMRKKAYVQQ LETSRLKLAQ LELEIDRARK  480
QGAYASSSLG TSHMGYNGAL NSGITTFEME YGHWVEEQHR QIVELRNALN DRXTDIELRK  540
LVDCGLNHYA ILFRMKADAA RVDIFYLLSG IWRTSVERHF HWIGGFRPSE LLNIVLPQLQ  600
PLTDQQRLDF CNLRQSSQQA EDALSQGMDK LQQALALSIA ADQMSGESFG CQMASALEKL  660
EALESFLSQA DHLRQQTLQQ MSRILTTHQA AQGLLALGEY FHRLRALSSL WTARPRKPT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.258780.0fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008338800.20.0transcription factor TGA7
RefseqXP_008338802.20.0transcription factor TGA7
RefseqXP_017178155.20.0transcription factor TGA7
RefseqXP_028950792.10.0transcription factor TGA7
SwissprotQ93ZE21e-147TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A498HZ000.0A0A498HZ00_MALDO; Uncharacterized protein
STRINGXP_008338800.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109634104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.11e-149bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]