PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000277239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 130aa    MW: 14936.3 Da    PI: 10.0443
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000277239genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.11.1e-4115105191
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                    +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg ++ ++++l++ k
  MDP0000277239  15 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPEHQRGDAVSSMVYEANARVRDPVYGCVGQFRLYNNKLMCFK 105
                    7**********************************************************************************99998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.46214115IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-4115105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MKENGSSRKQ GAPSPCAACK LLRRRCAQDC VFAPYFPADE PQKFANVHKV FGASNVNKML  60
QELPEHQRGD AVSSMVYEAN ARVRDPVYGC VGQFRLYNNK LMCFKPNWLW LRQRWCTSKC  120
VRPHHSRTMG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-4311101797LOB family transfactor Ramosa2.1
5ly0_B5e-4311101797LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.114620.0cell culture| fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359794.29e-64LOB domain-containing protein 4-like
RefseqXP_009353911.18e-64PREDICTED: LOB domain-containing protein 4
RefseqXP_009371914.11e-63PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE91e-56LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A498JUR42e-61A0A498JUR4_MALDO; Uncharacterized protein
STRINGXP_009353911.13e-63(Pyrus x bretschneideri)
STRINGXP_009371914.14e-63(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-59LOB domain-containing protein 4