PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000276955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 148aa    MW: 16631.4 Da    PI: 8.1363
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000276955genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26058.61.8e-18656151
         DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpe 51
                   +Ca C+++r+kC+ dC+lapyfp++ p +f n+hklFG+s+v+   ++ p+
  MDP0000276955  6 SCAXCQHQRKKCTVDCPLAPYFPSSYPTNFHNAHKLFGVSRVVDSTNSSPP 56
                   6******************************************99888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.5255107IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-16656IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MTNPQSCAXC QHQRKKCTVD CPLAPYFPSS YPTNFHNAHK LFGVSRVVDS TNSSPPSLPT  60
SEAPPCPPSX SSXPPRQRPC WRLPRRRPVA MAIAQTLEDF KDNVGXWNVY DHIQFHQVQK  120
KXSQEQEEQG NIGAGVPPQP QEEQANVF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009365511.11e-44PREDICTED: LOB domain-containing protein 25-like
TrEMBLA0A498JBD96e-97A0A498JBD9_MALDO; Uncharacterized protein
STRINGXP_009365511.15e-44(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2290723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-14LOB domain-containing protein 27