PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000273608
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 313aa    MW: 34560 Da    PI: 5.9764
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000273608genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.7e-18179233256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  MDP0000273608 179 RKKLRLSKDQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 233
                    778899***********************************************98 PP

2HD-ZIP_I/II127.46e-41179269192
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                    +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  MDP0000273608 179 RKKLRLSKDQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 269
                    69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.8E-827145IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.9E-17155236IPR009057Homeodomain-like
SuperFamilySSF466894.71E-18170236IPR009057Homeodomain-like
PROSITE profilePS5007117.086175235IPR001356Homeobox domain
SMARTSM003898.0E-16177239IPR001356Homeobox domain
CDDcd000863.87E-16179236No hitNo description
PfamPF000462.4E-15179233IPR001356Homeobox domain
PROSITE patternPS000270210233IPR017970Homeobox, conserved site
PfamPF021836.1E-11235269IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.5E-26235278IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MELALSLGDA SKPFLFLDKA PKIGSNKDLG FCMGLGSAAR SDESSRESTH EVYDQEEGRR  60
SRVSSDPPLQ LNLLPSAPVP RSRASSQLSF PWLTDNLAVS EPAGSSDGTG IGFDVNRMPG  120
VVASAEEAED TAAPLSSPNS TVSSFQMDFG MRSGGRSSKR DMEVDADRAS DDEENGSTRK  180
KLRLSKDQSA FLEESFKEHS TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD  240
CEYLKRCCET LTEENRRLQK ELQELRALKT SQPFYMQLPA TTLTMCPSCE RVVTTASXXX  300
TTPPPPPPPP TTT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177183TRKKLRL
2227235RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.232380.0bud| root
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028948814.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466651e-103HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A498I3R40.0A0A498I3R4_MALDO; Uncharacterized protein
STRINGXP_008392143.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.19e-91homeobox from Arabidopsis thaliana