PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000271556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GeBP
Protein Properties Length: 666aa    MW: 72204.8 Da    PI: 9.97
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000271556genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573116.51.6e-36159252198
         DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                    klfqr+ws+ Dei++L+G++d+++k+g++p++d+ af+ef+kks++++v k+ql +KirrLKkK++++vkk    k+++ +k+hdqk+f+lskk+W
  MDP0000271556 159 KLFQRIWSDXDEIIILKGMVDYTTKKGADPYSDMGAFHEFIKKSLKVDVXKTQLQDKIRRLKKKYETNVKK----KKFNPTKPHDQKVFDLSKKVW 250
                    579********************************************************************....99999**************** PP

         DUF573  97 gs 98 
                    gs
  MDP0000271556 251 GS 252
                    95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.6E-33161251IPR007592Protein of unknown function DUF573
SMARTSM004146.6E-78538658IPR002119Histone H2A
CDDcd000746.45E-67543655No hitNo description
Gene3DG3DSA:1.10.20.102.3E-61543657IPR009072Histone-fold
PfamPF001258.0E-13547624IPR007125Histone H2A/H2B/H3
PRINTSPR006202.4E-50549571IPR002119Histone H2A
SuperFamilySSF471132.7E-42551655IPR009072Histone-fold
PROSITE patternPS000460557563IPR032458Histone H2A conserved site
PRINTSPR006202.4E-50578593IPR002119Histone H2A
PRINTSPR006202.4E-50593606IPR002119Histone H2A
PRINTSPR006202.4E-50607621IPR002119Histone H2A
PfamPF162118.3E-18627660IPR032454Histone H2A, C-terminal domain
PRINTSPR006202.4E-50635653IPR002119Histone H2A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000786Cellular Componentnucleosome
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSAED EEVSSEEEGE EEESGSGSDS EPEEPLPPKT SSSAPVSEKK  60
PPPKKPDSSA ANSKPESSSS GSEADSDSDV DKDLVVKPIA SKPMEETPKT KKPRSKPAAT  120
ATPVAKSGSK RPSETEPKDS KRLKKKEPDQ LEEEAKKSKL FQRIWSDXDE IIILKGMVDY  180
TTKKGADPYS DMGAFHEFIK KSLKVDVXKT QLQDKIRRLK KKYETNVKKK KFNPTKPHDQ  240
KVFDLSKKVW GSSSSGEGSS GVSGXSEQPK SNGKXRNTKT LASIRADSLS SPEPPKEAAK  300
VDFGLNPCSS ESLSEVIGFD KGFGKLGLPE GVVKQGLELI GGPKRAELKE KWRKLHVAEL  360
ELFVKRSELM RDQTKRNGVG FGLRVWFICR HKAVVVFQIL TLEPSEVVSD VQYKGVRFVS  420
GRQSNPLSWW RNGEYACADF RARPTPVQPP TKLLPELPNS VVAAFGPPLF SNFRFRPLGS  480
FAGVESCGDE GTEGPLTRGG GGAGEAGKKW RENWSWGAAG KWGFGVEREE PEESMAGRGK  540
SIGSGTAKKA TSRSSKAGLQ FPVGRIARFL KAGKYAERVG AGAPVYLAAV LEYLAAEVLE  600
LAGNAARDNK KTRIVPRHIQ LAVRNDEELS KLLGAVTIAN GGVMPNIHNM LLPKKTGTGK  660
SGPAED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5oy7_e4e-595356611126Histone H2A
5x0x_C4e-595356611126Histone H2A
5x0x_G4e-595356611126Histone H2A
6ftx_C3e-595356611126Histone H2A type 1
6ftx_G3e-595356611126Histone H2A type 1
6g0l_G3e-595356611126Histone H2A type 1
6i84_Q4e-595356611126Histone H2A type 1
6i84_V4e-595356611126Histone H2A type 1
6j99_C4e-595356611126Histone H2A
6j99_G4e-595356611126Histone H2A
6n1z_B4e-595356611126Histone H2A
6n1z_E4e-595356611126Histone H2A
6ne3_C3e-595356611126Histone H2A type 1
6ne3_G3e-595356611126Histone H2A type 1
6o96_C4e-595356611126Histone H2A
6o96_G4e-595356611126Histone H2A
6om3_C4e-595356611126Histone H2A
6om3_G4e-595356611126Histone H2A
6om3_O4e-595356611126Histone H2A
6om3_S4e-595356611126Histone H2A
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216229RRLKKKYETNVKKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.16880.0bud| cell culture| fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028966266.10.0probable transcription factor At1g61730
TrEMBLA0A498IXL30.0A0A498IXL3_MALDO; Uncharacterized protein
STRINGXP_009366247.11e-171(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-27DNA-binding storekeeper protein-related transcriptional regulator