PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000269977
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Trihelix
Protein Properties Length: 287aa    MW: 34785.2 Da    PI: 8.2735
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000269977genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix773e-2448130186
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                    +W+ qe+++L+ +r e+++++ ++k++k lWe +s km+e+g +rs++qCk+kw+nl +ryk  +++e +     ++++p++++l+
  MDP0000269977  48 QWSVQETKDLLLIRAELDQTFMETKRNKLLWEVISTKMKEKGHHRSAEQCKCKWKNLVTRYKGFETMEPEA---MRQQFPFYNELQ 130
                    7********************************************************************95...55689*****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002845107IPR001005SANT/Myb domain
CDDcd122031.51E-2147110No hitNo description
PfamPF138371.1E-1948132No hitNo description
PROSITE profilePS500907.28249105IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MEHHPHHYQR HQQQHHQQLQ LQQQQQQLQQ QHLSTVTVHV DTSDRFPQWS VQETKDLLLI  60
RAELDQTFME TKRNKLLWEV ISTKMKEKGH HRSAEQCKCK WKNLVTRYKG FETMEPEAMR  120
QQFPFYNELQ EIFAARMQRM LWAEESGAAS GSKKKTLSSD DEEDNEDSEA ENKGSTGKNK  180
KKKMKMSNIG SSSASGNNVR ELLEEFMKQQ MQMEMQWREE FQARENERRL KEMEWRQKME  240
ALENERIMME TRWREREEQR RMREEARAEK RDVLITALLN KLRREDM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008370106.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804506e-72TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLB9HCX71e-116B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-54Trihelix family protein