PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000265875
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 157aa    MW: 17825.2 Da    PI: 5.8014
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000265875genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.84.1e-123087562
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                   ++ +r+ +NRe+ArrsR RK++ +  L+  +  L +eN + +  ++  ++++ k ++e
  MDP0000265875 30 RKRKRMLSNRESARRSRMRKQEHMTDLTAQIGLLMKENNRIITSMNVTNQLYMKIEAE 87
                   67899**********************************9998888888877776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-142690IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-1028110No hitNo description
PROSITE profilePS502179.8642891IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-113082No hitNo description
PfamPF001701.9E-93085IPR004827Basic-leucine zipper domain
CDDcd147021.19E-153182No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MASSSGVSSE SSKLQNSGSD ADLNLVMDQR KRKRMLSNRE SARRSRMRKQ EHMTDLTAQI  60
GLLMKENNRI ITSMNVTNQL YMKIEAENSV LRAQMDELTN RLQSLNDILD CINSSKWIYE  120
EEENHNIIGG GEGFLNPWSA GFLNNQPIMA SADMFMC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.119210.0fruit| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the micropylar endosperm and radicle tip in early germinating seeds. {ECO:0000269|PubMed:23461773}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008354657.11e-113bZIP transcription factor 11-like
SwissprotC0Z2L52e-45BZP44_ARATH; bZIP transcription factor 44
TrEMBLD9ZIQ24e-95D9ZIQ2_MALDO; BZIP domain class transcription factor
STRINGXP_008354657.11e-112(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61334147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.12e-42basic leucine-zipper 44
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  2. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]