PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000265429
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 176aa    MW: 19667.1 Da    PI: 7.2898
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000265429genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.27.9e-4571061100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+
  MDP0000265429   7 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLAV 102
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  MDP0000265429 103 AQAE 106
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8236107IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-447104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGSGSSPCAS CKLLRRRCAK DCIFAPYFPS DDPHKFAIVH KVFGASNVSK MLQELPIHQR  60
GDAVSSLVYE ANARVRDPVY GCVGAISFLQ NQVSQLQMQL AVAQAEILCI QMQQEPVALP  120
TQIDQHQHXH HHQDHDQKSL LLSNSDINSI PHQYFSSFAS PSNVIQDPLK RESLWT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.14390.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3786268e-98FQ378626.1 Vitis vinifera clone SS0AEB13YA05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008384740.11e-128PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW38e-84LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5W0D71e-105M5W0D7_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g07200.t013e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-80LBD family protein