PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000261199
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family Nin-like
Protein Properties Length: 658aa    MW: 74887.7 Da    PI: 7.8843
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000261199genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.12.6e-26170220252
         RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    +k +s +++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk++sl
  MDP0000261199 170 SKMLSRQTISQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLTSL 220
                    578999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.132152241IPR003035RWP-RK domain
PfamPF020422.2E-21173220IPR003035RWP-RK domain
PfamPF144327.9E-19555648IPR032867DYW domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MGWLAKYDVV KDRGEDPFFF PHQPTFPSVH DFRGYACDWQ FDLPIVQDHR FPDHPLPSLE  60
SCVNIDPIYS SLDILPIRTV LQDDEIFFGN GNALFGVNSN DLCGGLTEIN HNHHQQFQQQ  120
QQPPLLLTCK NDENGITDMN DSREXRDKAI SERPXSSKRH RSSSSSLSSS KMLSRQTISQ  180
YFYMPITQAA KELNVGLTLL KKRCRELGIR RWPHRKLTSL QTLIRNIQEL GKEGEEGEEK  240
LRNAIVLLEM EKKLLEEAPD MQLEDNTKRL RQACFKANYK KRKIMGTKLW PEVYAQIDEL  300
FLRAAANKNA YVFIRYLRXR GLLAGSMASS FVIKSCIRVS SLRDTVALGL FEIMQSEVHR  360
CEPDDVTCLL VLQACASLNA LEFGXXVHKY IEEHGYGGAS NLYDSLVEXS LDKAYGVFKG  420
MRYKNVVLWS AMISGLAVNG LCHCGLVDER MMIFDRMSKE FGVVPNIHHY GCMFDLLGRA  480
GRLDQAYQLI TSMNMKPDPT IWRTLLGACR IHGNNSLAER VVGNLIELKA QEAGDYVLLM  540
NIFSSAGTWE KLTEMRKFMK EKAIQTTPGY VTSELHNLGA EDKGLXPSYH SEXWAIAFGV  600
LSTTPGTPIR VAKNLRICVD CHNFAMALSG VYNREVIIRD RTRFHHFREG RCSCNGYX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5iww_D1e-143175658318PLS9-PPR
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374551.20.0LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g47530
SwissprotQ9SN851e-120PP267_ARATH; Pentatricopeptide repeat-containing protein At3g47530
TrEMBLA0A498JKV80.0A0A498JKV8_MALDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.15e-36RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Lurin C, et al.
    Genome-wide analysis of Arabidopsis pentatricopeptide repeat proteins reveals their essential role in organelle biogenesis.
    Plant Cell, 2004. 16(8): p. 2089-103
    [PMID:15269332]