PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000257227
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 314aa    MW: 35261.1 Da    PI: 6.5637
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000257227genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.11.4e-38311301100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++ ++++am+++++++++ra+dPv G++++i+++q+ +e  kael+ 
  MDP0000257227  31 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKHLDQPDKDEAMRTIIFQSDVRANDPVGGCYRIIREMQHLIEYNKAELDI 126
                    7********************************************************************************************998 PP

         DUF260  97 lkee 100
                    + ++
  MDP0000257227 127 ILHQ 130
                    7665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.3330131IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-3631126IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MSSSSHSHNH THHISTTTTT PSTKGNGNTQ ACAACKYQRR KCAPDCILAP YFPHDRQRQF  60
LNAHKLFGVS NITKIIKHLD QPDKDEAMRT IIFQSDVRAN DPVGGCYRII REMQHLIEYN  120
KAELDIILHQ LAICRAQAQQ VHQQQHQNPI QMPEIGDQNT CDLLINGDPL SLCGNPMGHF  180
HYIQQPQPPH HAVALQQEQP QEQQQQLPYV FVQNNANSNN NSDNNNGGPH AHPHHQHLHE  240
DVSIWAMQDS MSSLDIKQCG GGMNGIANGC EDLKPFLDQM GCGDDHDRNN GEVVDINGDH  300
QHSEEALLRV HRAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-24191251105LOB family transfactor Ramosa2.1
5ly0_B1e-24191251105LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008338722.10.0LOB domain-containing protein 22
SwissprotQ9LRW13e-58LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A498HDK90.0A0A498HDK9_MALDO; Uncharacterized protein
STRINGXP_008338722.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.17e-55LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]