PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000255235
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 343aa    MW: 37850.4 Da    PI: 8.1494
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000255235genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.34.8e-19247281135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  MDP0000255235 247 CSHCGVQKTPQWRTGPNGAKTLCNACGVRYKSGRL 281
                    *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.8E-17241295IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.426241277IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.38E-14242303No hitNo description
Gene3DG3DSA:3.30.50.103.2E-15245279IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.40E-14246294No hitNo description
PROSITE patternPS003440247272IPR000679Zinc finger, GATA-type
PfamPF003205.2E-17247281IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MECVEAALKT SIRKEMAVKA TGPQVVVFDD FLWGGAVVNG QNACDDFSVD DLLDFSNEDG  60
FVETEAEEEG DKEKVKGFVS VSLQKQNQET EKSNLSEKIE PASELSVPAD DLENLEWLSH  120
FVEDSFXEFX TALPAGFLPE KPKSEKRPDL ETPFPEKPCF KTPVPAKARS KRRRTGGRVW  180
SLGSPSLTES SSSSSSSSSS SPSSPWTIYP ATQNQESAEP VSSVEKPPRK PKRRLVDGSS  240
SQPPRRCSHC GVQKTPQWRT GPNGAKTLCN ACGVRYKSGR LLPEYRPACS PTFSSELHSN  300
HHRKVIEMRR KKEGPGTPEP XKKXQIDRPR NCVAAGGNRM HAK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.140070.0bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008357175.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH575e-85GATA5_ARATH; GATA transcription factor 5
TrEMBLD9ZIZ10.0D9ZIZ1_MALDO; GATA domain class transcription factor
STRINGVIT_04s0023g02880.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-78GATA transcription factor 5