PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000253782
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family G2-like
Protein Properties Length: 448aa    MW: 48543.9 Da    PI: 9.5476
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000253782genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32298351255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  MDP0000253782 298 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 351
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15295352IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28296352IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23298351IPR006447Myb domain, plants
PfamPF002492.6E-7299350IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MLREKGLSSE AAAGGRSCLA LNPIPDLSLH ISPPNTNTNS APSSICTDQV TPDHDSSSCF  60
DIWRRDTDED CTNXGALSNK SHSDSCIRAS YTSSSPAAAG ADTELSLANP SALEAESAWK  120
KNYFGGGDGY NDEAKNSGNS VTSSNGISML ERLKPIKGIP VYSTSSTNCS FPPSFSPNPV  180
YQTAPYLSNS FGPAAPARNC SGRGMGMGLG GFNGITMDSL SLGVGGVQQQ QQQRQRQHHF  240
PSYNLNPYYP QQLQQHHCVG GGGNYNADLS SNGFTMRSKF TPPKLIGQNI NKRNMRAPRM  300
RWTTSLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKNTDKPLA  360
SSGYQRPDST QAFLFQDKTS DPNLIVVAFR STEAWRTXLG LGISRAPTEL ETSPIQAIQK  420
TKMKPRRIGS RIVPIGGREK AEVGRKVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-17299353357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-17299353357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-17299353357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-17299353357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.170160.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008375024.20.0transcription repressor KAN1-like isoform X2
TrEMBLA0A498JL540.0A0A498JL54_MALDO; Uncharacterized protein
STRINGXP_008375023.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-39G2-like family protein