PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000250177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 1183aa    MW: 132870 Da    PI: 7.7347
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000250177genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.61.1e-34892988197
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++r+kC ++C+lapyfpa+++++f +vhk+FG+snv+k++k+++e +r+++++slv+eA +r++dPv Ga+g ++ ++ +l++ k++ ++
  MDP0000250177 892 ACAACKHQRKKCHAGCILAPYFPADRTREFLAVHKVFGVSNVTKMVKNVEEPNRRKVAESLVWEALCRQKDPVLGAYGEYRMVSDELKRYKQQQNR 987
                    7*****************************************************************************************998776 PP

         DUF260  97 l 97 
                     
  MDP0000250177 988 E 988
                    5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007430.3886142IPR014002Agenet domain, plant type
PfamPF056412.8E-891139IPR008395Agenet-like domain
SMARTSM007438.9E-16145201IPR014002Agenet domain, plant type
PROSITE profilePS513757.563216250IPR002885Pentatricopeptide repeat
PROSITE profilePS513757.903251285IPR002885Pentatricopeptide repeat
PROSITE profilePS513758.923286320IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007560.0023289322IPR002885Pentatricopeptide repeat
PfamPF130412.5E-10320368IPR002885Pentatricopeptide repeat
PROSITE profilePS5137510.457321355IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007561.6E-5324357IPR002885Pentatricopeptide repeat
PROSITE profilePS5137511.323356390IPR002885Pentatricopeptide repeat
TIGRFAMsTIGR007563.3E-7358391IPR002885Pentatricopeptide repeat
PROSITE profilePS5089123.263891992IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-33892986IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043574Biological Processperoxisomal transport
GO:0005730Cellular Componentnucleolus
GO:0005777Cellular Componentperoxisome
Sequence ? help Back to Top
Protein Sequence    Length: 1183 aa     Download sequence    Send to blast
MAPDLSRAFI KVLRLTRTGS HPLTHYIEQF LDLTKPTISS MNTHHGIVHL DGIPNSSLAS  60
MVNQMVSLTQ LNDVLDAKEP NTPMKEVPIE GTPVEVCIDK EGFQGGWFTA NIVKTIRTDD  120
NKKFLMEVVD AKQIRPYPPN LVLAESFSVT QEVDVFYNGC WWEGVIRNVL HGQRYKVYIK  180
GTNDELLFQH SDLRPRQDWI DGTWFIASQE QGLYPDPNIF VTVISRLGEH GKWDMIQKTI  240
ENMKCRGHMK SGIIYAVSVD IYGQYGKFQD ALECISALKA EGLIPSASMF CVLANAYAQQ  300
GLCHQTVKVL QLMEAEGIEP NVIMLNVLIN AFNVAGRYLE ALSIYHHIKE SGFSPDVVTY  360
TTLMKAFIRA RKFDKVPEIY KEIERARCTP DRRARQMLQV ALMVLQQRYW VVREARVLRD  420
NETCFWFSSW NMDNTVTCNT KALTSDLRGR VTFMSLVPMK SIDLEELASK VCEVPSLSRA  480
TAFISAGSKM EKEANGSSPS TELGMEPTAS GPSIWEQIEL SESYLVCSMY EEAASLASSI  540
LKPLSQHSQH LEADGDRFEL YDMSESAGMV LVQSLKQLGR TSEILNELKP LFASVATIPV  600
QVLLTGVCFY ISEGHSLGIQ EFLEEFLSSW SFVDEQYYVL ASTEKFADNA KRSDEHFVLG  660
VDKYLEVVEV YVLKLLGTVL NDVKLATSWV ETAELPEDRR QVLLRRLHSL HSVKATNSPQ  720
GSLSSSLEDN YDVEQIAVPA GYPKSRYGGT VKKQTVFSLS KKLEPCVWWF RTITLKFGSA  780
RVVISNGKIV SGFLILLIYY VLRRKQATIK RTIQRQALTM KNALVDLWQL AFSYQVNPLA  840
AVQPLAAATQ GGRSHLEPTR LSVFERILGN ICGFKIMQRT NNNGTAGSTQ PACAACKHQR  900
KKCHAGCILA PYFPADRTRE FLAVHKVFGV SNVTKMVKNV EEPNRRKVAE SLVWEALCRQ  960
KDPVLGAYGE YRMVSDELKR YKQQQNRENH IVPLQMQKGL CFNKSLSDLV GNWNGGITNV  1020
NNSGYLRDND DVIPDSAPFG YPLNCEQQSH EKVVKQVKMI DSVVVPLHQQ QQHYSVNNIN  1080
QQYYLTGSHG RILVQIRTLG IRVRGGAEYR PTGGGTTVTR ILMEVRLLQV LDAGRTEPSL  1140
LLQHRGFLTT ITGEEPSSLP AEEVCPASGP NTPVWGFGAQ FLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4m57_A5e-23200457113714Chloroplast pentatricopeptide repeat protein 10
4m59_A5e-23200465105706Chloroplast pentatricopeptide repeat protein 10
4m59_B5e-23200465105706Chloroplast pentatricopeptide repeat protein 10
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.270240.0fruit| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A498JHL40.0A0A498JHL4_MALDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF882822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.17e-40LOB domain-containing protein 2