PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000249507
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 360aa    MW: 39738.9 Da    PI: 8.3085
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000249507genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP60.85.3e-19251857
            TCP  8 hskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakp 57
                   hsk++ ++g+RdR+vRl + +a++f+d+qd+LG+d + k+++WL     p
  MDP0000249507  2 HSKVCMAKGPRDRSVRLAVYTAIQFYDIQDRLGYDGPNKAVDWLTSRQSP 51
                   9*******************************************876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136918.717156IPR017887Transcription factor TCP subgroup
PfamPF036342.1E-16247IPR005333Transcription factor, TCP
Gene3DG3DSA:3.20.20.804.4E-13151197IPR013781Glycoside hydrolase, catalytic domain
SuperFamilySSF514451.66E-72151340IPR017853Glycoside hydrolase superfamily
PfamPF002327.2E-10159196IPR001360Glycoside hydrolase family 1
PROSITE patternPS006530165179IPR033132Glycosyl hydrolases family 1, N-terminal conserved site
Gene3DG3DSA:3.20.20.805.7E-66198339IPR013781Glycoside hydrolase, catalytic domain
PfamPF002322.6E-48198339IPR001360Glycoside hydrolase family 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MHSKVCMAKG PRDRSVRLAV YTAIQFYDIQ DRLGYDGPNK AVDWLTSRQS PILLRLFPGR  60
CFYPGPSSSP TSTLISTRPP SGGGGSEATA AIAASVAVST RYSEMFNVLE RHRRTSCRNM  120
LGSKGGRLLF GFILVLFALL ASAAVEVEPS HYSMPFNRTS FPPGFIFGAG LAAYQSEGAA  180
LVHGRGPSIW DTFTREHPXG TVKGGVNQEG VNFYNNLIDE LLSNGIVPFV TLFHWDTPQA  240
LEDEYGGFLS PKIVNDFQDY ANFCFKTFGD RVKHWVTLNE PVTYCVDGYN GGTYAPGRCS  300
NYVGNCTAGN SATEPYIVGH HLLLAHAHAV KIYRHKYQIN YVILECKFER SWCILTLIVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wq6_B3e-821203381261beta-primeverosidase
3wq6_A3e-821203381261beta-primeverosidase
3wq5_B3e-821203381261Beta-primeverosidase
3wq5_A3e-821203381261Beta-primeverosidase
3wq4_B3e-821203381261Beta-primeverosidase
3wq4_A3e-821203381261Beta-primeverosidase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008346957.11e-156PREDICTED: vicianin hydrolase-like
SwissprotA2SY668e-87VICHY_VICSN; Vicianin hydrolase (Fragment)
TrEMBLM5XFD11e-115M5XFD1_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s23460.14e-92(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15030.36e-19TCP family protein