PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000239602
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 136aa    MW: 15756 Da    PI: 10.3876
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000239602genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind95.74.8e-3052120169
                    HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SS CS
   HSF_DNA-bind   1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdee 69 
                    +Fl+k++++++d+e++++isws+  +sf+v+d  ef++++Lpk+Fkh+nf+SF+RQLn+YgF+kv+++ 
  MDP0000239602  52 TFLNKTFQMVDDPETDSIISWSDARQSFIVWDLYEFSRTLLPKHFKHNNFSSFIRQLNTYGFRKVDQDM 120
                    6****************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.9E-3145119IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.5E-3549132IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467854.08E-2649118IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.2E-2553119IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.9E-205376IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.9E-2091103IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS00434092116IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.9E-20104116IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MSEPHLPSPH PPLYSLSLPT LPLLQPTREP PHSIRAPRSL SSTKFARGGP TTFLNKTFQM  60
VDDPETDSII SWSDARQSFI VWDLYEFSRT LLPKHFKHNN FSSFIRQLNT YGFRKVDQDM  120
LKGFRREDAG PRWKIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B9e-21521162892Heat shock factor protein 1
5d5v_B9e-21521162892Heat shock factor protein 1
5d5v_D9e-21521162892Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress responses. Seems to be involved in other environmental stress responses. Activates ascorbate peroxidase 2 (APX2) in addition to several heat shock protein (HSPs). {ECO:0000269|PubMed:16649111, ECO:0000269|PubMed:17059409, ECO:0000269|PubMed:17085506}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress, high light and hydrogen peroxide (H(2)O(2)). {ECO:0000269|PubMed:16649111, ECO:0000269|PubMed:17059409, ECO:0000269|PubMed:17085506}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008388138.21e-39heat stress transcription factor A-2-like
RefseqXP_008388143.21e-39heat stress transcription factor A-2-like
SwissprotO809821e-29HSFA2_ARATH; Heat stress transcription factor A-2
TrEMBLA0A498KFB66e-38A0A498KFB6_MALDO; Uncharacterized protein
STRINGXP_009361628.11e-38(Pyrus x bretschneideri)
STRINGXP_008388138.11e-38(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.11e-32heat shock transcription factor A2
Publications ? help Back to Top
  1. Liu HC,Charng YY
    Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development.
    Plant Physiol., 2013. 163(1): p. 276-90
    [PMID:23832625]
  2. Jung HS, et al.
    Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9
    [PMID:23918368]
  3. Chauhan H,Khurana N,Agarwal P,Khurana JP,Khurana P
    A seed preferential heat shock transcription factor from wheat provides abiotic stress tolerance and yield enhancement in transgenic Arabidopsis under heat stress environment.
    PLoS ONE, 2013. 8(11): p. e79577
    [PMID:24265778]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Weng M, et al.
    Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana.
    Plant Cell Environ., 2014. 37(9): p. 2128-38
    [PMID:24548003]
  6. Jang YH, et al.
    A homolog of splicing factor SF1 is essential for development and is involved in the alternative splicing of pre-mRNA in Arabidopsis thaliana.
    Plant J., 2014. 78(4): p. 591-603
    [PMID:24580679]
  7. Stief A, et al.
    Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors.
    Plant Cell, 2014. 26(4): p. 1792-1807
    [PMID:24769482]
  8. Dobrá J, et al.
    The impact of heat stress targeting on the hormonal and transcriptomic response in Arabidopsis.
    Plant Sci., 2015. 231: p. 52-61
    [PMID:25575991]
  9. Yamauchi Y,Kunishima M,Mizutani M,Sugimoto Y
    Reactive short-chain leaf volatiles act as powerful inducers of abiotic stress-related gene expression.
    Sci Rep, 2015. 5: p. 8030
    [PMID:25619826]
  10. Shi H, et al.
    Melatonin induces class A1 heat-shock factors (HSFA1s) and their possible involvement of thermotolerance in Arabidopsis.
    J. Pineal Res., 2015. 58(3): p. 335-42
    [PMID:25711624]
  11. Mueller SP,Krause DM,Mueller MJ,Fekete A
    Accumulation of extra-chloroplastic triacylglycerols in Arabidopsis seedlings during heat acclimation.
    J. Exp. Bot., 2015. 66(15): p. 4517-26
    [PMID:25977236]
  12. Nie S,Yue H,Xing D
    A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance.
    Plant Physiol., 2016.
    [PMID:26099269]
  13. Nguyen AH, et al.
    Loss of Arabidopsis 5'-3' Exoribonuclease AtXRN4 Function Enhances Heat Stress Tolerance of Plants Subjected to Severe Heat Stress.
    Plant Cell Physiol., 2015. 56(9): p. 1762-72
    [PMID:26136597]
  14. Hu Z, et al.
    Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis.
    Plant J., 2015. 84(6): p. 1178-91
    [PMID:26576681]
  15. Lämke J,Brzezinka K,Bäurle I
    HSFA2 orchestrates transcriptional dynamics after heat stress in Arabidopsis thaliana.
    Transcription, 2016. 7(4): p. 111-4
    [PMID:27383578]
  16. Wang X,Huang W,Liu J,Yang Z,Huang B
    Molecular regulation and physiological functions of a novel FaHsfA2c cloned from tall fescue conferring plant tolerance to heat stress.
    Plant Biotechnol. J., 2017. 15(2): p. 237-248
    [PMID:27500592]
  17. Chen ST,He NY,Chen JH,Guo FQ
    Identification of core subunits of photosystem II as action sites of HSP21, which is activated by the GUN5-mediated retrograde pathway in Arabidopsis.
    Plant J., 2017. 89(6): p. 1106-1118
    [PMID:27943531]
  18. Kataoka R,Takahashi M,Suzuki N
    Coordination between bZIP28 and HSFA2 in the regulation of heat response signals in Arabidopsis.
    Plant Signal Behav, 2017. 12(11): p. e1376159
    [PMID:28873003]
  19. Wang X,Zhuang L,Shi Y,Huang B
    Up-Regulation of HSFA2c and HSPs by ABA Contributing to Improved Heat Tolerance in Tall Fescue and Arabidopsis.
    Int J Mol Sci, 2018.
    [PMID:28914758]
  20. Llamas E,Pulido P,Rodriguez-Concepcion M
    Interference with plastome gene expression and Clp protease activity in Arabidopsis triggers a chloroplast unfolded protein response to restore protein homeostasis.
    PLoS Genet., 2017. 13(9): p. e1007022
    [PMID:28937985]
  21. Li X, et al.
    Plastid Translation Elongation Factor Tu Is Prone to Heat-Induced Aggregation Despite Its Critical Role in Plant Heat Tolerance.
    Plant Physiol., 2018. 176(4): p. 3027-3045
    [PMID:29444814]