PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000234166
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 345aa    MW: 37766.4 Da    PI: 6.1882
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000234166genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.85.4e-092623021353
                    HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                    NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+
  MDP0000234166 262 NRQSAARSKERKMRYIAELEQKVQTLQTEATSLSAQLTLLQ 302
                    **********************************9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-10249314IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.13E-10257304No hitNo description
CDDcd147038.57E-21259304No hitNo description
PROSITE profilePS502179.542262315IPR004827Basic-leucine zipper domain
PfamPF001703.6E-7262302IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-10262308No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MDKDKSHAHG GGFPPPSGRY SSFLPTGAAF NVKPEPSSSS SFPPLASGAS ADSGHFSHDI  60
SRMPDNPPRK LGHRRAHSEI LTLPDDISFD SDLGVVGGAD DPSFSDETEE DLFSMYLDME  120
KFNSSSATSS FQFGEPSSSA AAPAPVIAPV SRAPTSSAEN IAIGSNERLR VRHQHSQSMD  180
GSSTIKPEML VSSSEDINAA DSKKSLSAAK LAELALIDPK RAKRSMPLMI LSLQSSYRLI  240
FKAMELVFQE SCLDSIRWIW ANRQSAARSK ERKMRYIAEL EQKVQTLQTE ATSLSAQLTL  300
LQRDANGLTA ENSELKLRLQ TMEQQVHLQD GELLLPFMIR INFHV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.134911e-165cell culture| fruit| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222595.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-116POF21_ARATH; Probable transcription factor PosF21
TrEMBLM5XCD00.0M5XCD0_PRUPE; Uncharacterized protein
STRINGXP_008384422.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55173249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-109bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]