PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000223109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 172aa    MW: 20010 Da    PI: 6.2428
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000223109genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.78.3e-38151141100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaC++lrr+C  +C lapyfp e+  kfa vh++FGasnv+k+++ ++e++reda++++vyeA ar+rdPvyG+++ i++lq+ +e+l+++l++
  MDP0000223109  15 PCAACRMLRRRCDINCSLAPYFPIEEIDKFAGVHRVFGASNVIKMIQMVEETRREDAVKAIVYEATARIRDPVYGSTAAIFHLQKMIEELRSQLET 110
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +k++
  MDP0000223109 111 IKSQ 114
                    9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.51914115IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3715112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MDGQITPMRT RVHQPCAACR MLRRRCDINC SLAPYFPIEE IDKFAGVHRV FGASNVIKMI  60
QMVEETRRED AVKAIVYEAT ARIRDPVYGS TAAIFHLQKM IEELRSQLET IKSQVLELQQ  120
HRDQLLGILM NNVHSLDLFS DMHDPMFGES SKVQEDPVWD LEPRDERQRE RV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-3461162112LOB family transfactor Ramosa2.1
5ly0_B9e-3461162112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017188837.11e-126LOB domain-containing protein 1-like
TrEMBLA0A498JAZ81e-123A0A498JAZ8_MALDO; Uncharacterized protein
STRINGXP_008233120.11e-89(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-44LOB domain-containing protein 1