PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000220844
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 414aa    MW: 44911 Da    PI: 6.8435
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000220844genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA596.2e-19330364135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  MDP0000220844 330 CSHCGVQKTPQWRTGPNGAKTLCNACGVRYKSGRL 364
                    *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.426324360IPR000679Zinc finger, GATA-type
SMARTSM004012.8E-17324378IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.18E-14325386No hitNo description
Gene3DG3DSA:3.30.50.104.1E-15328362IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.75E-14329377No hitNo description
PfamPF003206.7E-17330364IPR000679Zinc finger, GATA-type
PROSITE patternPS003440330355IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MGGCIKCEGA QXKKKATDAS SPNSMLYQTH PXLFIPIPSL SPFTCSILSS TSTSPLSLSS  60
HSLSPPLLLS SSQLSPPQQV GTEMECVEAA LKTSIRKEMA VKAAGPQAVV FDDLLWGGAV  120
VNGQNACDDF SVDDLLDFSN EDGFFVTEGE EEDDKEKVKA FVSVSPQKQN QETEKSNLSE  180
KVEPASELSV PADDLVNLEW LSHFVEDSFS EFATALPAVF VPENPMSEKR PDPETAFPEK  240
PCFKTPVPAK ARSKRTRTGG RVWSLGSPSL TESSSSSSSS SSSSPSNPWL IYPSTQNQEP  300
GEPVLSLEKP PKKPKRRLVD GSSSQPPRRC SHCGVQKTPQ WRTGPNGAKT LCNACGVRYK  360
SGRLLPEYRP ACSPTFSSEL HSNHHRKVLE MRRKKEGPGT PEPGLTRPPV VPSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1310316PKKPKRR
2310317PKKPKRRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.140070.0bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008337889.10.0PREDICTED: GATA transcription factor 5
SwissprotQ9FH577e-87GATA5_ARATH; GATA transcription factor 5
TrEMBLD9ZIZ10.0D9ZIZ1_MALDO; GATA domain class transcription factor
STRINGVIT_04s0023g02880.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-75GATA transcription factor 5