PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000220708
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 176aa    MW: 19277.8 Da    PI: 8.1425
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000220708genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.3e-40121111100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk l+r+C++ C++apyf +++pkkfa vhk+FGasnv+k+l+++pe++r d+++sl+yeAear+rdPvyG++g i+ l++++ ql+++la 
  MDP0000220708  12 SCAACKSLKRRCTPTCIFAPYFRSDEPKKFAQVHKVFGASNVSKILTEVPEDQRADTVNSLAYEAEARLRDPVYGCIGAISMLERKMIQLQHDLAI 107
                    6*********************************************************************************************99 PP

         DUF260  97 lkee 100
                    ++++
  MDP0000220708 108 ARAR 111
                    9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.08611112IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-4012109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MKGSHEPRSS SSCAACKSLK RRCTPTCIFA PYFRSDEPKK FAQVHKVFGA SNVSKILTEV  60
PEDQRADTVN SLAYEAEARL RDPVYGCIGA ISMLERKMIQ LQHDLAIARA RLVCYAPKNS  120
PSSSSSCSCC PMLDEGTFSG FPAWSGLNGN NFSQNASELI SQHGQTSDFS YSSYIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4571166115LOB family transfactor Ramosa2.1
5ly0_B1e-4571166115LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374922.11e-130LOB domain-containing protein 21-like
SwissprotQ9SRL82e-61LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A498KKS31e-128A0A498KKS3_MALDO; Uncharacterized protein
STRINGXP_008374922.11e-129(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.14e-52LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]