PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000216231
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 375aa    MW: 42591.6 Da    PI: 5.9829
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000216231genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601292.1e-40741741101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rrkC ++C+lapyfp +qpk f+n+hklFG+sn+lk+lk+l++ ++ +am+s++y+A++r + PvyG+ +vi++lq q+  +++el++
  MDP0000216231  74 ACAACKYQRRKCRAECPLAPYFPPDQPKMFQNAHKLFGVSNILKILKNLEPRQKLEAMRSIIYQANVRDKFPVYGCWEVIWQLQYQILVAEEELQA 169
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    ++++l
  MDP0000216231 170 VHQQL 174
                    *9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.07673174IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-3874171IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MFPISPLPFL LPLLLLQLTA TLLLLLLLIL FNLNHCITLL SNCFRGFSPS RLSDWFQSXF  60
GIQKMTLKGT TSQACAACKY QRRKCRAECP LAPYFPPDQP KMFQNAHKLF GVSNILKILK  120
NLEPRQKLEA MRSIIYQANV RDKFPVYGCW EVIWQLQYQI LVAEEELQAV HQQLAMYRQH  180
HQQQHQISSM PEYVTSQLEL GMAPPNNPLP LFIHNPPPYN HNNNNNATAV APVNQXQQQS  240
YSNSSDAAYS SAAYNIDSKD IITNTNNNNN DAGNPMWISN PFMTNNSNNN NNNSEAIQSE  300
LGVLQPLSIQ PEVVQDYDEL HPFFDTIDDR QSYIDSKEAY DSSSEESFKD TTRSMEHAEN  360
ALKNAAACFS LTSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-297517712114LOB family transfactor Ramosa2.1
5ly0_B5e-297517712114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008346755.30.0LOB domain-containing protein 27-like
SwissprotQ9STS61e-63LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A498HZI10.0A0A498HZI1_MALDO; Uncharacterized protein
STRINGXP_009343462.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-49LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]