PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000215106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 408aa    MW: 45853.4 Da    PI: 8.9918
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000215106genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.34.3e-15247289547
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                    +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+k
  MDP0000215106 247 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLRK 289
                    79***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-14236290No hitNo description
SMARTSM003385.5E-11243302IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.76245290IPR004827Basic-leucine zipper domain
PfamPF001705.5E-13247290IPR004827Basic-leucine zipper domain
CDDcd147075.21E-24247292No hitNo description
SuperFamilySSF579596.25E-11247291No hitNo description
PROSITE patternPS000360250265IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSQGGADGN CKQPQFQPLG RQNSMYSLTL DEVQNQLGDL GKPLSSMNLD ELLKNVWSVE  60
ANQTMGIDIE GTTLVNQAQL QRQASLSLTS ALSKKTVDEV WRDIQQSKDE EEKKSQERQR  120
TLGEMTLEDF LVKAGVVAEA EASSDKQCAG PLVGVDANVA AQFPQGQWMQ YSQPQYQHPQ  180
QSMMGVYMPS QPIPPPMHVG AGAMMEVPYP DNQVPLPSPL MGALSDTPTP GRKRGNPEDI  240
VEKTVERRQK RMIKNRESAA RSRARKQAYT NELENKVSRL EEENERLRKQ KFYEPSKYQK  300
NSFWPVPVFG LYYGLVQMIK CKTVWIFLKD FHEHFKGLSL KDRKTKTKLL LLPALPMNVL  360
TTSSTLNIGI VSCSLNAFVD KQELEKVLPS APPPEPKYQL RRTSSAPL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.135540.0bud| fruit| leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7863070.0AY786307.1 Malus x domestica bZIP transcription factor (ZIP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008375407.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2
SwissprotQ9LES36e-81AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLD9ZIQ30.0D9ZIQ3_MALDO; BZIP domain class transcription factor
STRINGXP_008375404.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.17e-68ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]