PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000212434
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WOX
Protein Properties Length: 271aa    MW: 30410.1 Da    PI: 8.672
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000212434genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.9e-213190357
                   --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                   +R+++tkeq++ Le+++++  r+psae++++++++l    +++ ++V++WFqN++a++++
  MDP0000212434 31 SRWNPTKEQIDMLENFYKQgVRTPSAEQIQQITSSLkafgHIEGKNVFYWFQNHKARQRQ 90
                   7*****************99**************************************96 PP

2Wus_type_Homeobox1131.6e-363092365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++RW+Pt+eQi +Le+ yk+G+rtP++e+iq+it++L+++G+ie+kNVfyWFQN+kaR+rqkq
      MDP0000212434 30 TSRWNPTKEQIDMLENFYKQGVRTPSAEQIQQITSSLKAFGHIEGKNVFYWFQNHKARQRQKQ 92
                       79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.3212691IPR001356Homeobox domain
SuperFamilySSF466891.88E-132798IPR009057Homeodomain-like
SMARTSM003891.4E-72895IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.9E-93190IPR009057Homeodomain-like
PfamPF000468.2E-193190IPR001356Homeobox domain
CDDcd000868.06E-83292No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEGDHHHSAV LLDQRHVQAG SGRAGDSGST SRWNPTKEQI DMLENFYKQG VRTPSAEQIQ  60
QITSSLKAFG HIEGKNVFYW FQNHKARQRQ KQKQESIAYN RLLHRRTTQP IFLPPYDLNL  120
PCPNVMCSPY YVPVHSELGF YPQSPYPNKV PLPGVPSVVK RRPRAEKLEK RRTTCTTGGA  180
GYEPMNPHNG YNTSGGSDMI NDATSKLISK CDQQTLPLFP LQPTGILQQG REDQNYPSTV  240
NDADCSSAAL IGSIAEQIVG DRQPFYDFFS A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008385223.10.0WUSCHEL-related homeobox 2
TrEMBLA0A498IMG30.0A0A498IMG3_MALDO; Uncharacterized protein
STRINGXP_008385223.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-52WUSCHEL related homeobox 2