PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000209424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 1013aa    MW: 113077 Da    PI: 7.2608
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000209424genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.91.3e-0666122157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    +r+R  ++++ ++ +++ F  + ++s++e +eL++  g+t +qV+ +F  +R + kk
  MDP0000209424  66 KRPRDLLNPKAIKYMQSIFSIKDTISKKESRELSALFGVTVTQVRDFFNSQRSRVKK 122
                    799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.0963123IPR001356Homeobox domain
SuperFamilySSF466899.41E-765126IPR009057Homeodomain-like
SMARTSM003892.3E-465127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-666131IPR009057Homeodomain-like
CDDcd000864.12E-566122No hitNo description
Gene3DG3DSA:1.20.930.101.1E-6222313IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.15E-5225312IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1013 aa     Download sequence    Send to blast
MENLSVEMEI GTSAESFGKF LDSQRELFHS QIDQLQRIVG TQCKLTGVNP LSQEMAAGAL  60
SIKIGKRPRD LLNPKAIKYM QSIFSIKDTI SKKESRELSA LFGVTVTQVR DFFNSQRSRV  120
KKLVQLSREK ALKSGEHEDL RDGVSTSPDS LIPSDPVPLN SVGPSTVDDA PSCSTQDNAL  180
SGLDDLDKRF VEDIFNLMRK EETFSGQVKL MEWIMRIQNS SVLCWFLTNG GVIILVTWLS  240
EAAVEEQTSV LLVILKVLCH LPLHKALPLH MSAVLQSVNR LRFYRTPDIS NRARVLLSRW  300
SKLLARSQAM KKPNGIKTSS DSEDIDEVMG DSESWKSNMD ISEDILGTHF ESAETRKLEA  360
SEPLKLLTAS PDESNKKNIL GVSSSRILNI EFRERRKVQL VEQPGQSAGR SVPATRTTTV  420
SQARPMSADD IQKAKMRAQF MQSKYGKSRS SHENKELKTE GVDKLTISQA SILPVVPKVP  480
IRSNIEEPKK PATYPLKERE VPNKPETSLA PKRSLDLKEP ILEKCQRIQI PWKMPPEEAE  540
TEIPDNVKFV HYYLIWFFGC LMASVSAEEI KFDPSWSVGG GEYCKEIEVQ RNRNRREKET  600
IYRTVQEIPS NPKEPWDIEM DYDDSLTPEI PIEQPPDVAD TTETQASHNR EVHNAETMVV  660
PSQGANSVAS FPPALSQINN ASAAEPDLEL LAVLLKNPEL VFALTSGDAA NLSSEDTVKL  720
LDMIKSGGVG GVGVAGNVNG LGRKMEERVE VSLPSPTPSS NPGTSGWKGD AGRNAFPQRM  780
PQVSSAHHII PPQRLSTSQP AVPSYSPDYH RMQSPASEMA LTMKDTHFHN VSNTAVPSVW  840
GESTINHEQA PLSNSYNVAE RQQPLYSTPA RQQRQPQPVQ QSRFSEPHIP MYTPKQPMGK  900
PGPPSDSWRA GQDLPSKYHY IENQNQYNAS SGGHLQPHLL SGPSWEGNEH VGGNQDFQSW  960
SPDNSPRRNP GYMYGREHRT NPGQDYRSRG RNPAGYRDHN RQQGNRWPNR GGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.148340.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368980.20.0LOW QUALITY PROTEIN: homeobox protein LUMINIDEPENDENS-like
TrEMBLA0A498KAW10.0A0A498KAW1_MALDO; Uncharacterized protein
STRINGXP_008368979.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein