PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000204639
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 808aa    MW: 87735.9 Da    PI: 5.5728
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000204639genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.34.1e-21120175156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    ++k  ++t++q++eLe++F+++++p++++r eL ++lgL+ +qVk+WFqNrR+ +k
  MDP0000204639 120 KKKYLRHTPDQIQELENFFKECPHPDEKQRSELGRRLGLESKQVKFWFQNRRTHMK 175
                    688999**********************************************9998 PP

2START187.85.5e-593275472206
                    HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS..........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
          START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.........dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                    la++a++elvk++++++p+W kss   +++n +e+        +           +ea r++ vv+ ++  lve+l+d + +W e+++    +a+t
  MDP0000204639 327 LALAAMDELVKMVQVDSPLWIKSSdgtDILNIEEYQA------FscigmkpssLVTEATRDTCVVIVNSLALVEILMDAN-RWAEMFQclvaRAST 415
                    6899********************7665555555433......333345678789*************************.*************** PP

                    EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
          START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                    ++ is+g      galqlm+aelq+lsplvp R   f+R+++q+ +g+w++vdvS+d +q+ p++ ++v +++lpSg+++++++n+ skvtw+eh+
  MDP0000204639 416 IDMISNGmdgtrnGALQLMYAELQMLSPLVPvRPLKFLRFCKQHAEGVWAVVDVSIDINQEGPNTNPFVDCRRLPSGCIVQDMPNNCSKVTWIEHT 511
                    ************************************************************************************************ PP

                    E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                    +++++++h l+r  ++sg+ +ga++w+atlqrqce+
  MDP0000204639 512 EYDENIVHHLFRESLRSGMGFGAQRWLATLQRQCES 547
                    **********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-20103177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-22106171IPR009057Homeodomain-like
PROSITE profilePS5007117.734117177IPR001356Homeobox domain
SMARTSM003896.5E-19119181IPR001356Homeobox domain
CDDcd000867.02E-19120177No hitNo description
PfamPF000461.2E-18120175IPR001356Homeobox domain
PROSITE profilePS5084842.564317550IPR002913START domain
SuperFamilySSF559611.48E-32318548No hitNo description
CDDcd088757.50E-112321546No hitNo description
SMARTSM002341.9E-42326547IPR002913START domain
PfamPF018521.3E-50327547IPR002913START domain
Gene3DG3DSA:3.30.530.207.2E-7379530IPR023393START-like domain
SuperFamilySSF559611.15E-20568795No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
MSLGGLISSS GGGNSGRGRG RVVAEIAPHA PSFMPSGTIA HAHFLSSPIP NPRQTSSSAL  60
SLSIQKMDGH GELGFAENFD PGIIGRLRDD EYESKSGSDN FEGASGDDQD GGGGDQRPRK  120
KKYLRHTPDQ IQELENFFKE CPHPDEKQRS ELGRRLGLES KQVKFWFQNR RTHMKTQLER  180
HENIILRQEN DKLIAENGVM KDAISNPVCN NCGGPAIPGQ ISFDEHQLRI ENARLKEELN  240
RICALANKLP ISSLGIPGSI PNATSGLELG VGRNGMDGMN AVSAGLPMGL DLGDGVSSSS  300
LMIPLVKTSS GMMGNEVPFE RSMYIDLALA AMDELVKMVQ VDSPLWIKSS DGTDILNIEE  360
YQAFSCIGMK PSSLVTEATR DTCVVIVNSL ALVEILMDAN RWAEMFQCLV ARASTIDMIS  420
NGMDGTRNGA LQLMYAELQM LSPLVPVRPL KFLRFCKQHA EGVWAVVDVS IDINQEGPNT  480
NPFVDCRRLP SGCIVQDMPN NCSKVTWIEH TEYDENIVHH LFRESLRSGM GFGAQRWLAT  540
LQRQCESLAF LISSANSNED LSGIEVSGKK SMLKLAQRMV DNFCAGISAS SVRKWDKLCF  600
ENVSEDVRVM ARKSMNDPGE PPGIVLSVTT TVWVPVSRHR VFEFLRDEQF RKDWDILSSG  660
VPMQRIVQIG KGQGGANSVS LLRANAPDAN NSNVLILQET WTDPTGSLVV YAPVDTESIN  720
VVMRGGDSAY VALLPSGFAI LPGGPPGYGV VKSEGNGYGG GGGCLLTVAF QILVSSLPTA  780
KINMESVETV STLISCTIQK IKSSLLAA
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376544.10.0homeobox-leucine zipper protein HDG7 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A498JJE70.0A0A498JJE7_MALDO; Uncharacterized protein
STRINGXP_008376544.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]