PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000200822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family bZIP
Protein Properties Length: 152aa    MW: 17657.1 Da    PI: 9.2867
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000200822genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.73e-1464118559
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                    ++ rr+ +NRe+ArrsR RKk  +e L+ +v+ L+ eN++Lk++l    +++  l
  MDP0000200822  64 RKRRRMTSNRESARRSRWRKKRHLEDLTSEVDRLKIENQELKNRLGLVAQKCHVL 118
                    5779999****************************************99999866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.4E-1257118No hitNo description
SMARTSM003386.7E-1460124IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.0762114IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.63E-1264119No hitNo description
PfamPF001704.8E-1264119IPR004827Basic-leucine zipper domain
CDDcd147026.41E-1665116No hitNo description
PROSITE patternPS0003606782IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MMMSSSAMSF IHEPADMGRF ECPVQETVLT TAEIQELLSL LQAGNSASPS SEGSNREVDT  60
VDERKRRRMT SNRESARRSR WRKKRHLEDL TSEVDRLKIE NQELKNRLGL VAQKCHVLWR  120
ENDRMTSESL ALRARLSDLY RILIAMQTQY SQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16367RKRRR
26584RRRMTSNRESARRSRWRKKR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008377948.21e-108basic leucine zipper 4-like
SwissprotQ9LQ655e-27BZIP4_ARATH; Basic leucine zipper 4
TrEMBLA0A498J9Z71e-107A0A498J9Z7_MALDO; Uncharacterized protein
STRINGXP_008377948.11e-102(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59963052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59530.12e-29basic leucine-zipper 4
Publications ? help Back to Top
  1. Guo YL, et al.
    Genome-wide comparison of nucleotide-binding site-leucine-rich repeat-encoding genes in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 757-69
    [PMID:21810963]
  2. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Ma H, et al.
    ZmbZIP4 Contributes to Stress Resistance in Maize by Regulating ABA Synthesis and Root Development.
    Plant Physiol., 2018. 178(2): p. 753-770
    [PMID:30126870]