PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000197526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 247aa    MW: 27026.2 Da    PI: 6.7805
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000197526genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.63.3e-418106199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk++rrkC+++Cv+apyfp +qp+kfanvh ++Gasnv k+l++l+   reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q++++l  
  MDP0000197526   8 PCAACKFQRRKCTQECVFAPYFPPDQPQKFANVHTVYGASNVGKILNELNVAYREDAVTSLAYEAEARLRDPVYGCVGFISFLQNRLKQVQTDLYN 103
                    7********************************************************************************************988 PP

         DUF260  97 lke 99 
                    +k+
  MDP0000197526 104 AKK 106
                    876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9827108IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-408105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSSNTHSPCA ACKFQRRKCT QECVFAPYFP PDQPQKFANV HTVYGASNVG KILNELNVAY  60
REDAVTSLAY EAEARLRDPV YGCVGFISFL QNRLKQVQTD LYNAKKDLYA YVGPQALMIP  120
LLGATTGPPP QQGCRGGQLL IRDQHQQQLF EAHQQELVRF NINGMDAAAS LVNGNGFSQI  180
PAAAASTGVV SGSLGLGGAF DNNHYNQIQQ EAAAHHQNSL DHQLQARLML QPHPAQESQQ  240
KSEGEES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-45711110114LOB family transfactor Ramosa2.1
5ly0_B6e-45711110114LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028964806.10.0LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-61LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A498IUH30.0A0A498IUH3_MALDO; Uncharacterized protein
STRINGXP_009377477.11e-172(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-61ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]