PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000195431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family VOZ
Protein Properties Length: 346aa    MW: 38301.1 Da    PI: 5.7573
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000195431genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ188.33e-581532771127
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pp saf +pkcalw+c+rp++    +qd css ha+la neglpg tpvlrp+gi lkdg+lfaal+ k+qgk+vgip c+gaat +spw+ +elf
  MDP0000195431 153 PPASAFKRPKCALWECSRPVHV--LCQDXCSSGHAHLARNEGLPGKTPVLRPWGIALKDGSLFAALNDKTQGKDVGIPDCDGAATLRSPWDDPELF 246
                    789*****************86..6*********************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqr 127
                    dl l eget rewlff +prrafesgnrk+r
  MDP0000195431 247 DLFLHEGETPREWLFFGRPRRAFESGNRKRR 277
                    *****************************98 PP

Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTKESKGKCE AASHKLLKEK AKTRVQKLRG MFTNIQIARK EGRTADMAIF EDQMDQMLGG  60
WIAELNDPSI ASSLHGGSXG RLESFSDDLA RFSKQQCDEK DDAESPLKDL PQPNLEGPEP  120
EDFIVSFKGP PEDXFQDLEF PDVVPDVMPD ICPPASAFKR PKCALWECSR PVHVLCQDXC  180
SSGHAHLARN EGLPGKTPVL RPWGIALKDG SLFAALNDKT QGKDVGIPDC DGAATLRSPW  240
DDPELFDLFL HEGETPREWL FFGRPRRAFE SGNRKRRLEL KFGTAKKSSK GKQSNDPVGR  300
LTAEASTEVG NNSKXTTSKN AEAGNIFGSD NQTNSLYLNP EMSWKC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.112081e-116bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009354289.11e-160PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-81VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A498HCH30.0A0A498HCH3_MALDO; Uncharacterized protein
STRINGXP_008342960.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.24e-84vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]