PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000194766
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 168aa    MW: 18781.5 Da    PI: 6.8581
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000194766genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.82.2e-4461051100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+CakdC++ap fp+++p+kfanvhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la+
  MDP0000194766   6 PCASCKLLRRRCAKDCIFAPFFPSDDPHKFANVHKIFGASNVSKMLQELPVHQRADAVSSLVYEANARMRDPVYGCVGAISYLQNQVSELQMQLAV 101
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  MDP0000194766 102 AQAE 105
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7575106IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAGTSPCASC KLLRRRCAKD CIFAPFFPSD DPHKFANVHK IFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA NARMRDPVYG CVGAISYLQN QVSELQMQLA VAQAEILCIK MQHEPMVPPQ  120
QIMDGPDDQK SYFLHNNNLA QYLSFPPSSN VIHDSLNREN IFGHDMVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009345367.11e-123PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-74LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5X1C15e-99M5X1C1_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s19180.14e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-75LBD family protein