PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000194672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HSF
Protein Properties Length: 713aa    MW: 80153.3 Da    PI: 6.8607
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000194672genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind94.79.7e-301482802102
                    HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTT....................... CS
   HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekksks....................... 74 
                    Fl+k++++++d+e+++++sws+  +sf+v+d  ef++++Lpk+Fkh+nf+SF+RQLn+Y+  +    +++  +                       
  MDP0000194672 148 FLNKTFQMVDDPETDSIVSWSDARQSFIVWDLYEFSSTLLPKHFKHNNFSSFIRQLNTYEGXRGVGFTSNCXHvsdfwvvxpefrstgxgsaxday 243
                    9**********************************************************76554443333333568999*********99999999 PP

                    .........XTTSEEEEESXXXXXXXXXXXXXXXXXX CS
   HSF_DNA-bind  75 .........kekiweFkhksFkkgkkellekikrkks 102
                             +++ weF+++ F+ gk++ll++ikr+++
  MDP0000194672 244 sctqgfrkvDPDRWEFANERFQGGKRHLLKNIKRRRR 280
                    88877765449***********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-33144278IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004154.7E-46144278IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.36E-27144214IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004479.9E-27148278IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-13148171IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-13186198IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.7E-13199211IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.36E-27246278IPR011991Winged helix-turn-helix DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MVDPDVGGXS GGGDGGGXPX XPFPSKTQLT EPSKNLEEAE NELDRAKEEV TELKKEDKAV  60
TFSEGRNFDR SFSSSSSTAP PNPAAELLKV KEETVDVVVV DNDLEGGDHC KTINGGGGGG  120
DFGSLSSSSS MELPKPMEGL REAGPPPFLN KTFQMVDDPE TDSIVSWSDA RQSFIVWDLY  180
EFSSTLLPKH FKHNNFSSFI RQLNTYEGXR GVGFTSNCXH VSDFWVVXPE FRSTGXGSAX  240
DAYSCTQGFR KVDPDRWEFA NERFQGGKRH LLKNIKRRRR YNKKPNXVSA DSPKPGLEAE  300
IESLKKDQDF LRLEILNLRQ QQKYSQHQLT AFXQRIXSSL CKQQRMLFFL TKTAVNPISV  360
QQLMQKRMIK RELDGGDLGK RRRLPPAQGI ESFDEWINDS LSFDCRNQVQ EEPVPMQTAL  420
AEQISEAIAS QQNGTPLSSP MVDKSCNAVH MRVTPWXSKL AALAECLEFH SRNRRMKMQP  480
QVNQELLXLI LSWFHHHLST DSPDPNHFCT ASSPLPLHTN PNRHCFSMAX SSSPSXDXVS  540
XANSSXASSP SSITIXNIGS MVXIKLTTTN YXTWSXLFAX IFRRYNLTXI IDGSQVAPSK  600
YLCDSSXNRT STLNPAFVNW YENDXNIXIW INSTLSDSLI PYTVGVSSSR ELWAKLXSRL  660
ATXSQSHIHE LXSXLRSITK DKXEXFLVFT HFKSMVENLL CXKXVTLILV ESF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B9e-191202781129Heat shock factor protein 1
5d5v_B9e-191202781129Heat shock factor protein 1
5d5v_D9e-191202781129Heat shock factor protein 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1271277LKNIKRR
2379383KRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008388138.20.0heat stress transcription factor A-2-like
RefseqXP_008388143.20.0heat stress transcription factor A-2-like
TrEMBLA0A498KFB60.0A0A498KFB6_MALDO; Uncharacterized protein
STRINGXP_008388138.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106762938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.12e-61heat shock transcription factor A2