PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000193877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HD-ZIP
Protein Properties Length: 303aa    MW: 34005.6 Da    PI: 7.1992
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000193877genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.33e-19146200256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tkeq  +Le+ F+++ +++ ++++eLA+kl+L  rqV vWFqNrRa+ k
  MDP0000193877 146 RKKLRLTKEQSATLEDSFREHTTLNPKQKQELARKLNLRPRQVEVWFQNRRARTK 200
                    78889************************************************98 PP

2HD-ZIP_I/II121.35e-39146233188
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                    +kk+rl+keq+++LE+sF+e+++L+p++K+elar+L+l+prqv+vWFqnrRARtk+kq+E ++e Lk+++++lk+en+rL+ke +eL+
  MDP0000193877 146 RKKLRLTKEQSATLEDSFREHTTLNPKQKQELARKLNLRPRQVEVWFQNRRARTKLKQTEAECELLKQCCETLKDENRRLHKELQELK 233
                    69*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.68E-19135203IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-18136196IPR009057Homeodomain-like
PROSITE profilePS5007117.783142202IPR001356Homeobox domain
SMARTSM003892.8E-17144206IPR001356Homeobox domain
CDDcd000862.83E-17145203No hitNo description
PfamPF000461.0E-16146200IPR001356Homeobox domain
PROSITE patternPS000270177200IPR017970Homeobox, conserved site
PfamPF021836.8E-8202234IPR003106Leucine zipper, homeobox-associated
SMARTSM003408.6E-16202245IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGFDHEACNT GLGLSLGCQG NPDHHTNLQA FDLDHQKKKK IQLKYDHLLP ALTLGPSSGA  60
SKIEAAKSDD HLLQVVXVQA QEXASSPCSG AVSSFSNSSS FKRDRGLGVE EIEGEVEEDR  120
VVNITTSSRV SDELYDQDQD HEGSPRKKLR LTKEQSATLE DSFREHTTLN PKQKQELARK  180
LNLRPRQVEV WFQNRRARTK LKQTEAECEL LKQCCETLKD ENRRLHKELQ ELKLMKHTAT  240
AAAPLYMKFP TATLTMCPSC EKICNGGDHY NHNHESSTSP FLVGSNKTHL IFNPYSTHPS  300
TAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194202RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.86460.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347591.20.0homeobox-leucine zipper protein HAT22-like
TrEMBLA0A498J7S00.0A0A498J7S0_MALDO; Uncharacterized protein
STRINGXP_008347591.10.0(Malus domestica)
STRINGXP_008377934.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-66HD-ZIP family protein