PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000193702
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family SBP
Protein Properties Length: 511aa    MW: 56473.9 Da    PI: 7.51
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000193702genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.55e-40145220176
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                    +Cqv+gC++dl+  k+yh+rh+vC++hsk++vv+v+g+eqrfCqqCsrfh l efD+ krsCr+rLa+hn rrrk+
  MDP0000193702 145 TCQVHGCNMDLTFSKDYHKRHRVCDAHSKTAVVIVNGIEQRFCQQCSRFHLLAEFDDVKRSCRKRLAGHNLRRRKP 220
                    6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.804143220IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.103.6E-32143207IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.62E-37144224IPR004333Transcription factor, SBP-box
PfamPF031101.1E-30146219IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MESWSFGSEG KGXLFPEEID IPTDAFSRNT RKPFLELDDK TCFNFGKESV DRVGFIDLGF  60
PDSNQGVEIL NGVVCNDSSY NSVASPSCLI SSSSSFGEGE SGSKFSGPVT ECSSMDSSMI  120
ALKLGSLXDS RAGNGTRSSY YPAPTCQVHG CNMDLTFSKD YHKRHRVCDA HSKTAVVIVN  180
GIEQRFCQQC SRFHLLAEFD DVKRSCRKRL AGHNLRRRKP LLDTLDCKPH KLIRTCQGNG  240
YMGSSXXKGT PFGFSDILPD GCILHPEYEQ AXQYGNVKSE DRSTYGQSVT PIPNRQFIPK  300
SFHHLPGLGE QFAPGTPLSG NEYSVFDTAS NAQKAFGASN SSCALSLLSA QSHNLSSHSA  360
GVQVPNPLXN QRAHHCXGQL NEKTSRVNSM ENCGRNRSYP FSKKSMGANH MESVNISDSS  420
HAADFQLHTD RAYHVSDCLS AKYCVSPERG TTFXLLQLSS HLQRVEHERN FLQDIRADSI  480
KNGVNECAGC WRQFGSSASE FQHFHRGWEK L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-261462191184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.20991e-176bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028951685.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A498HI740.0A0A498HI74_MALDO; Uncharacterized protein
STRINGXP_008339783.10.0(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-44SBP family protein